KEGG   Bacillus subtilis subsp. subtilis 168: BSU35460Help
Entry
BSU35460          CDS       T00010                                 

Gene name
comFB
Definition
(RefSeq) ComF operon protein 2
  KO
K02241  competence protein ComFB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00429  Competence-related DNA transformation transporter
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU35460 (comFB)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   BSU35460 (comFB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComFB
Motif
Other DBs
NCBI-GeneID: 936749
NCBI-ProteinID: NP_391426
Pasteur: BG10396
BSORF: BG10396
UniProt: P39146
Structure
PDB: 

Position
complement(3641811..3642107)
Genome map
AA seq 98 aa AA seqDB search
MLVNSKEIVMKELLDRYMDQLHMACTCQVCQNDVLALSLNKVSPSYVTDFKKIAYTKAEL
VDKQKNTAMLVILAESAAVVSESPSDLCQTKQEEAFIN
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtcaattcaaaagaaatcgtaatgaaagaactgctcgaccgatatatggaccag
cttcatatggcctgtacttgccaagtatgccaaaacgatgtattggcactttctttaaac
aaagtgagtccatcctacgttactgattttaaaaagatcgcatatacgaaagctgagctg
gtagataaacaaaaaaacacagcaatgcttgtcattttggctgaatctgctgcagtagtt
tcagagagtccaagcgatttatgtcaaacgaagcaggaggaggcattcataaactga

DBGET integrated database retrieval system