KEGG   Bacillus subtilis subsp. subtilis 168: BSU35460
Entry
BSU35460          CDS       T00010                                 

Symbol
comFB
Name
(RefSeq) ComF operon protein 2
  KO
K02241  competence protein ComFB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU35460 (comFB)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   BSU35460 (comFB)
SSDB
Motif
Pfam: ComFB
Other DBs
NCBI-GeneID: 936749
NCBI-ProteinID: NP_391426
Pasteur: BG10396
BSORF: BG10396
UniProt: P39146 A0A6M3ZH34
Structure
PDB: 
4WAI

Position
complement(3641811..3642107)
AA seq 98 aa
MLVNSKEIVMKELLDRYMDQLHMACTCQVCQNDVLALSLNKVSPSYVTDFKKIAYTKAEL
VDKQKNTAMLVILAESAAVVSESPSDLCQTKQEEAFIN
NT seq 297 nt   +upstreamnt  +downstreamnt
atgcttgtcaattcaaaagaaatcgtaatgaaagaactgctcgaccgatatatggaccag
cttcatatggcctgtacttgccaagtatgccaaaacgatgtattggcactttctttaaac
aaagtgagtccatcctacgttactgattttaaaaagatcgcatatacgaaagctgagctg
gtagataaacaaaaaaacacagcaatgcttgtcattttggctgaatctgctgcagtagtt
tcagagagtccaagcgatttatgtcaaacgaagcaggaggaggcattcataaactga

DBGET integrated database retrieval system