KEGG   Bacillus subtilis subsp. subtilis 168: BSU35470Help
Entry
BSU35470          CDS       T00010                                 

Gene name
comFA
Definition
(RefSeq) ComF operon protein 1
  KO
K02240  competence protein ComFA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00429  Competence-related DNA transformation transporter
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU35470 (comFA)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   BSU35470 (comFA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C ResIII DEAD Flavi_DEAD AAA_30 Plant_tran PP_kinase AAA_19 AAA_22
Motif
Other DBs
NCBI-GeneID: 938537
NCBI-ProteinID: NP_391427
Pasteur: BG10395
BSORF: BG10395
UniProt: P39145
Position
complement(3642167..3643558)
Genome map
AA seq 463 aa AA seqDB search
MNVPVEKNSSFSKELQQTLRSRHLLRTELSFSDEMIEWHIKNGYITAENSISINKRRYRC
NRCGQTDQRYFSFYHSSGKNKLYCRSCVMMGRVSEEVPLYSWKEENESNWKSIKLTWDGK
LSSGQQKAANVLIEAISKKEELLIWAVCGAGKTEMLFPGIESALNQGLRVCIATPRTDVV
LELAPRLKAAFQGADISALYGGSDDKGRLSPLMISTTHQLLRYKDAIDVMIIDEVDAFPY
SADQTLQFAVQKARKKNSTLVYLSATPPKELKRKALNGQLHSVRIPARHHRKPLPEPRFV
WCGNWKKKLNRNKIPPAVKRWIEFHVKEGRPVFLFVPSVSILEKAAACFKGVHCRTASVH
AEDKHRKEKVQQFRDGQLDLLITTTILERGVTVPKVQTGVLGAESSIFTESALVQIAGRT
GRHKEYADGDVIYFHFGKTKSMLDARKHIKEMNELAAKVECTD
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtgccagttgaaaaaaacagttccttttcaaaagaattgcagcagacgcttcga
agccgtcatttgctcaggactgagctctcattttccgatgagatgattgaatggcatatc
aagaatggatatatcactgctgaaaattctatatccataaataaacggagatatagatgt
aataggtgcggacaaactgatcagcggtatttttctttttatcactcatctggaaagaat
aagctgtattgccgttcctgtgtcatgatgggcagagtgagtgaggaggttcctttatat
tcatggaaagaggaaaatgaatcaaactggaagtctattaagctgacatgggatggcaag
ctttcaagcggacagcaaaaagccgccaatgttttaattgaagcaatatcaaaaaaagaa
gagctcctcatctgggcggtttgcggcgctggcaaaacagaaatgctgtttcctggtata
gaatcagcgttaaatcaaggactgcgtgtatgtattgcaacacctcgcaccgatgttgta
ttagagcttgctccaagactcaaggctgcctttcagggtgctgacatttcagcgctttac
ggaggaagcgatgacaaagggcggctatctccgcttatgatttccactacgcatcagctt
ttgcgatataaagatgcaatcgatgttatgatcattgatgaagttgacgcttttccatat
tctgctgatcaaacccttcaattcgctgttcaaaaagcaagaaagaaaaacagcaccctc
gtttatttaagtgcaacacctcctaaagaattaaaaagaaaagcactgaacggacagtta
cattcagttcgcatccccgcaagacaccaccggaaacctttacccgaaccgcgctttgta
tggtgtggaaactggaagaagaaattaaaccgaaataaaattccgccagcggtgaaaaga
tggatagagtttcatgtaaaagaagggaggcctgtttttttattcgttccttccgtttct
attctggaaaaggctgctgcgtgctttaaaggtgttcattgccgaaccgcatctgtgcac
gcggaagacaagcatagaaaggagaaagtgcagcaattcagagatggtcagctcgatcta
ttaatcacaacaacaatactggaaagaggcgtcacagtccccaaggtgcaaacgggtgta
ctaggagcggaatcgtctatctttacggaaagcgcacttgttcaaattgcaggaagaacc
ggccggcataaagaatatgcggacggcgatgtcatttactttcacttcggcaaaacaaag
agtatgctcgatgcaagaaagcatataaaagaaatgaatgaattggcagcaaaagttgaa
tgtacagactag

DBGET integrated database retrieval system