KEGG   Bacillus subtilis subsp. subtilis 168: BSU35480Help
Entry
BSU35480          CDS       T00010                                 

Gene name
yviA
Definition
(RefSeq) protein DegV
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegV Dak1_2 DUF1281_C
Motif
Other DBs
NCBI-GeneID: 936763
NCBI-ProteinID: NP_391428
Pasteur: BG10394
BSORF: BG10394
UniProt: P32436
Structure
PDB: 

Position
complement(3643664..3644509)
Genome map
AA seq 281 aa AA seqDB search
MNIAVVTDSTAYIPKEMREQHQIHMIPLQVVFREETYREEIELDWKSFYEEVKKHNELPT
TSQPPIGELVALYEELGKSYDAVISIHLSSGISGTFSSAAAADSMVDNIDVYPFDSEISC
LAQGFYALKAAELIKNGASSPEDIIKELEEMKKTVRAYFMVDDLAHLQRGGRLSSAQAFI
GSLLKVKPILHFDNKVIVPFEKIRTRKKAISRIYELLDEDASKGLPMRAAVIHANREEEA
AKIIEELSAKYPHVEFYNSYFGAVIGTHLGEGALGICWCFK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcagtcgtaacagacagcacggcatatattccgaaagaaatgcgtgaacaa
catcagatacatatgatccctctccaggttgtttttagggaggagacttaccgtgaagaa
attgagttggactggaaaagcttttatgaagaagtgaaaaaacataatgagctcccgacg
acttctcagccgccaatcggcgagctggttgcgttgtatgaagagcttggcaagtcttat
gatgcggttatcagtatccatctttccagcgggatcagcggaacattcagcagtgcagca
gcggctgattcgatggtcgacaatattgatgtgtatccatttgactcagagatcagctgc
ttggctcaaggcttttatgcccttaaagctgctgaattaatcaaaaacggagcatcatcg
ccggaagatattataaaagaactggaagaaatgaaaaaaacagttcgagcttattttatg
gtagatgacttagcccatcttcagcgcggcgggcgattaagcagcgcccaagccttcatt
ggtagtcttctaaaggtaaagcctatccttcattttgacaataaggtaattgtgcctttt
gagaagattcgcacacgtaaaaaagcaatttcgcgaatttatgagcttttagacgaagat
gcgagtaaagggttgcctatgcgagctgctgttatccacgctaatcgagaggaagaagca
gcgaaaatcattgaagagctttctgcaaaatatcctcatgttgaattttataacagctat
tttggcgcggtaatcggcactcatttgggtgaaggtgcgttaggaatttgctggtgtttt
aaataa

DBGET integrated database retrieval system