KEGG   Bacillus subtilis subsp. subtilis 168: BSU35480
Entry
BSU35480          CDS       T00010                                 

Symbol
yviA
Name
(RefSeq) protein DegV
  KO
K25232  fatty acid kinase fatty acid binding subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99983 Lipid metabolism
    BSU35480 (yviA)
SSDB
Motif
Pfam: DegV Dak1_2 Peptidase_M32
Other DBs
NCBI-GeneID: 936763
NCBI-ProteinID: NP_391428
Pasteur: BG10394
BSORF: BG10394
UniProt: P32436 A0A6M3ZGW6
Structure
Position
complement(3643664..3644509)
AA seq 281 aa
MNIAVVTDSTAYIPKEMREQHQIHMIPLQVVFREETYREEIELDWKSFYEEVKKHNELPT
TSQPPIGELVALYEELGKSYDAVISIHLSSGISGTFSSAAAADSMVDNIDVYPFDSEISC
LAQGFYALKAAELIKNGASSPEDIIKELEEMKKTVRAYFMVDDLAHLQRGGRLSSAQAFI
GSLLKVKPILHFDNKVIVPFEKIRTRKKAISRIYELLDEDASKGLPMRAAVIHANREEEA
AKIIEELSAKYPHVEFYNSYFGAVIGTHLGEGALGICWCFK
NT seq 846 nt   +upstreamnt  +downstreamnt
atgaatattgcagtcgtaacagacagcacggcatatattccgaaagaaatgcgtgaacaa
catcagatacatatgatccctctccaggttgtttttagggaggagacttaccgtgaagaa
attgagttggactggaaaagcttttatgaagaagtgaaaaaacataatgagctcccgacg
acttctcagccgccaatcggcgagctggttgcgttgtatgaagagcttggcaagtcttat
gatgcggttatcagtatccatctttccagcgggatcagcggaacattcagcagtgcagca
gcggctgattcgatggtcgacaatattgatgtgtatccatttgactcagagatcagctgc
ttggctcaaggcttttatgcccttaaagctgctgaattaatcaaaaacggagcatcatcg
ccggaagatattataaaagaactggaagaaatgaaaaaaacagttcgagcttattttatg
gtagatgacttagcccatcttcagcgcggcgggcgattaagcagcgcccaagccttcatt
ggtagtcttctaaaggtaaagcctatccttcattttgacaataaggtaattgtgcctttt
gagaagattcgcacacgtaaaaaagcaatttcgcgaatttatgagcttttagacgaagat
gcgagtaaagggttgcctatgcgagctgctgttatccacgctaatcgagaggaagaagca
gcgaaaatcattgaagagctttctgcaaaatatcctcatgttgaattttataacagctat
tttggcgcggtaatcggcactcatttgggtgaaggtgcgttaggaatttgctggtgtttt
aaataa

DBGET integrated database retrieval system