KEGG   Bacillus subtilis subsp. subtilis 168: BSU35490Help
Entry
BSU35490          CDS       T00010                                 

Gene name
degU
Definition
(RefSeq) transcriptional regulatory protein DegU
  KO
K07692  two-component system, NarL family, response regulator DegU
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02024  Quorum sensing
Module
bsu_M00478  DegS-DegU (multicellular behavior control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU35490 (degU)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU35490 (degU)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU35490 (degU)
Two-component system [BR:bsu02022]
 NarL family
  DegS-DegU [MD:M00478]
   BSU35490 (degU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 Sigma70_r4 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 936751
NCBI-ProteinID: NP_391429
Pasteur: BG10393
BSORF: BG10393
UniProt: P13800
Position
complement(3644607..3645296)
Genome map
AA seq 229 aa AA seqDB search
MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDDGDEAARIVEHYHPDVVIMDINMP
NVNGVEATKQLVELYPESKVIILSIHDDENYVTHALKTGARGYLLKEMDADTLIEAVKVV
AEGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYPEIRRPLHILTRRECEVLQMLADG
KSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAVVVAIKNGWVEMR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaagtaaacattgttattatcgacgaccatcagttatttcgtgaaggtgttaaa
cggatattggattttgaacctacctttgaagtggtagccgaaggtgatgacggggacgaa
gcggctcgtattgttgagcactatcatcctgatgttgtgatcatggatatcaatatgcca
aacgtaaatggtgtggaagctacaaaacagcttgtagagctgtatcctgaatctaaagta
attattctatcaattcacgatgacgaaaattatgtaacacatgccctgaaaacaggtgca
agaggttatctgctgaaagagatggatgctgatacattaattgaagcggttaaagtagtg
gctgagggcggatcttacctccatccgaaggttactcacaacctcgttaacgaattccgc
cgccttgcaacaagcggagtttctgcacaccctcaacatgaggtttaccctgaaatccgc
agaccattacatattttaactaggcgggaatgtgaagtgctgcagatgcttgcagacgga
aaaagcaaccgcggtattggtgaatcattgtttatcagtgagaaaaccgttaaaaaccat
gtcagcaatattttacaaaaaatgaatgtaaacgaccggacgcaagccgttgtggtcgcc
attaaaaatggctgggtagaaatgagatag

DBGET integrated database retrieval system