KEGG   Bacillus subtilis subsp. subtilis 168: BSU35510Help
Entry
BSU35510          CDS       T00010                                 

Gene name
yvyE
Definition
(RefSeq) IMPACT family member YvyE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0029 DUF1949
Motif
Other DBs
NCBI-GeneID: 936754
NCBI-ProteinID: NP_391431
Pasteur: BG11052
BSORF: BG11052
UniProt: P32437
Position
3646753..3647406
Genome map
AA seq 217 aa AA seqDB search
MLHSYFTVKEAGEHEIVIEKSRFICHLSRVSTEQEAQEFIQKIKKQHWNATHNCSAYVIG
ENDHIQKANDDGEPSGTAGVPMLEVLKKRRLKDTCAVVTRYFGGIKLGAGGLIRAYGKSV
SEGLNHIGVVERKLMRIMHTSADYTWLGKIENELRESQFLLKEIHYSENVEFETYVEEKE
TNAFSEWMTELTNGKSDIKEGELTYLEKAVNHIKETE
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacagctattttactgtgaaagaagcgggagaacacgagattgttatagaaaaa
tcgcgttttatctgtcatttaagccgtgtttctaccgaacaagaggcacaggaatttata
cagaaaataaagaaacagcactggaatgcgactcataattgctcggcttatgttattggc
gagaatgatcatatccaaaaagccaatgatgacggggaaccaagcggtacagcgggagtg
ccgatgctcgaggttttaaaaaaacgcaggctgaaggatacttgcgccgtcgttacacgc
tacttcggaggcattaagcttggtgctggcggattaattcgcgcttatgggaaatcagtg
tctgaaggattaaatcatataggtgttgtagaacggaagcttatgcgaatcatgcatact
tctgcagattacacatggcttggcaagattgaaaatgaattaagggagtcacaatttctg
ttaaaggaaatccattattcagaaaatgttgaattcgaaacatacgtggaagaaaaagaa
accaacgctttttctgaatggatgacagaactgacaaatggaaagagtgatattaaagag
ggagagttgacgtatcttgaaaaagccgtcaatcacataaaggagactgaataa

DBGET integrated database retrieval system