KEGG   Bacillus subtilis subsp. subtilis 168: BSU35520Help
Entry
BSU35520          CDS       T00010                                 

Gene name
yvhJ
Definition
(RefSeq) transcriptional regulator YvhJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytR_cpsA_psr DUF4840 ETRAMP
Motif
Other DBs
NCBI-GeneID: 936761
NCBI-ProteinID: NP_391432
Pasteur: BG12449
BSORF: BG12449
UniProt: P96499
Structure
PDB: 

Position
3647406..3648581
Genome map
AA seq 391 aa AA seqDB search
MAERVRVRVRKKKKSKRRKILKRIMLLFALALLVVVGLGGYKLYKTINAADESYDALSRG
NKSNLRNEVVDMKKKPFSILFMGIEDYATKGQKGRSDSLIVVTLDPKNKTMKMLSIPRDT
RVQLAGDTTGSKTKINAAYSKGGKDETVETVENFLQIPIDKYVTVDFDGFKDVINEVGGI
DVDVPFDFDEKSDVDESKRIYFKKGEMHLNGEEALAYARMRKQDKRGDFGRNDRQKQILN
ALIDRMSSASNIAKIDKIAEKASENVETNIRITEGLALQQIYSGFTSKKIDTLSITGSDL
YLGPNNTYYFEPDATNLEKVRKTLQEHLDYTPDTSTGTSGTEDGTDSSSSSGSTGSTGTT
TDGTTNGSSYSNDSSTSSNNSTTNSTTDSSY
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgcgttagagtgcgtgtgcgaaaaaagaaaaagagcaaacgtaggaaaatt
ttaaaaagaataatgttattgttcgcccttgcactattggtagttgtagggcttggcggg
tataaactttataaaaccattaacgctgcggatgaatcgtacgatgccctatcccgcggg
aataaatcaaatcttcgcaacgaagttgtagacatgaagaaaaaaccattttctatttta
tttatgggaatagaggattacgcgactaaaggacaaaaagggagatcagactctcttatt
gttgttaccctggatcccaaaaataaaaccatgaaaatgctgagcattccgcgtgacaca
cgtgtgcaattagctggtgacacaacgggaagcaagacgaagatcaatgccgcttacagc
aaaggcggtaaagatgaaacagttgaaactgttgaaaacttcttgcaaatcccgatcgat
aaatatgtcacagttgattttgacggatttaaagatgtgattaatgaagtcggcggtatt
gatgttgacgtgcctttcgatttcgatgaaaaaagtgatgtagacgaaagcaaacggatt
tacttcaaaaaaggcgagatgcatttgaacggcgaagaagccttagcatatgcccggatg
agaaaacaggataaacgcggagactttggccgtaatgacagacaaaaacaaatcttaaac
gcgctgattgaccgcatgtcaagtgcaagcaacattgctaaaattgataaaatcgcagaa
aaagccagcgaaaacgttgaaaccaatattcgcattactgaaggtttagcgcttcagcag
atttacagcggctttaccagcaaaaaaatcgacacattgagcattacaggttctgatttg
tatttagggcctaacaacacatattactttgaacctgatgctacaaatctcgagaaagtc
agaaaaacgcttcaagagcatttagattatactcctgatacaagcactggcacttccggt
accgaagacgggactgacagctcaagcagttctggcagcactggcagcactggcacaaca
actgacgggacgacgaacggaagcagctattcgaatgacagcagcacaagctcaaacaac
agtacaacgaattcaacaactgattcatcctattaa

DBGET integrated database retrieval system