KEGG   Bacillus subtilis subsp. subtilis 168: BSU35520
Entry
BSU35520          CDS       T00010                                 

Symbol
yvhJ
Name
(RefSeq) transcriptional regulator YvhJ
  KO
K01005  polyisoprenyl-teichoic acid--peptidoglycan teichoic acid transferase [EC:2.7.8.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU35520 (yvhJ)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     BSU35520 (yvhJ)
SSDB
Motif
Pfam: LytR_cpsA_psr DUF4840
Other DBs
NCBI-GeneID: 936761
NCBI-ProteinID: NP_391432
Pasteur: BG12449
BSORF: BG12449
UniProt: P96499 A0A6M4JPN8
Structure
Position
3647406..3648581
AA seq 391 aa
MAERVRVRVRKKKKSKRRKILKRIMLLFALALLVVVGLGGYKLYKTINAADESYDALSRG
NKSNLRNEVVDMKKKPFSILFMGIEDYATKGQKGRSDSLIVVTLDPKNKTMKMLSIPRDT
RVQLAGDTTGSKTKINAAYSKGGKDETVETVENFLQIPIDKYVTVDFDGFKDVINEVGGI
DVDVPFDFDEKSDVDESKRIYFKKGEMHLNGEEALAYARMRKQDKRGDFGRNDRQKQILN
ALIDRMSSASNIAKIDKIAEKASENVETNIRITEGLALQQIYSGFTSKKIDTLSITGSDL
YLGPNNTYYFEPDATNLEKVRKTLQEHLDYTPDTSTGTSGTEDGTDSSSSSGSTGSTGTT
TDGTTNGSSYSNDSSTSSNNSTTNSTTDSSY
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggctgaacgcgttagagtgcgtgtgcgaaaaaagaaaaagagcaaacgtaggaaaatt
ttaaaaagaataatgttattgttcgcccttgcactattggtagttgtagggcttggcggg
tataaactttataaaaccattaacgctgcggatgaatcgtacgatgccctatcccgcggg
aataaatcaaatcttcgcaacgaagttgtagacatgaagaaaaaaccattttctatttta
tttatgggaatagaggattacgcgactaaaggacaaaaagggagatcagactctcttatt
gttgttaccctggatcccaaaaataaaaccatgaaaatgctgagcattccgcgtgacaca
cgtgtgcaattagctggtgacacaacgggaagcaagacgaagatcaatgccgcttacagc
aaaggcggtaaagatgaaacagttgaaactgttgaaaacttcttgcaaatcccgatcgat
aaatatgtcacagttgattttgacggatttaaagatgtgattaatgaagtcggcggtatt
gatgttgacgtgcctttcgatttcgatgaaaaaagtgatgtagacgaaagcaaacggatt
tacttcaaaaaaggcgagatgcatttgaacggcgaagaagccttagcatatgcccggatg
agaaaacaggataaacgcggagactttggccgtaatgacagacaaaaacaaatcttaaac
gcgctgattgaccgcatgtcaagtgcaagcaacattgctaaaattgataaaatcgcagaa
aaagccagcgaaaacgttgaaaccaatattcgcattactgaaggtttagcgcttcagcag
atttacagcggctttaccagcaaaaaaatcgacacattgagcattacaggttctgatttg
tatttagggcctaacaacacatattactttgaacctgatgctacaaatctcgagaaagtc
agaaaaacgcttcaagagcatttagattatactcctgatacaagcactggcacttccggt
accgaagacgggactgacagctcaagcagttctggcagcactggcagcactggcacaaca
actgacgggacgacgaacggaagcagctattcgaatgacagcagcacaagctcaaacaac
agtacaacgaattcaacaactgattcatcctattaa

DBGET integrated database retrieval system