KEGG   Bacillus subtilis subsp. subtilis 168: BSU35530Help
Entry
BSU35530          CDS       T00010                                 

Gene name
tagO
Definition
(RefSeq) undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase
  KO
K02851  UDP-GlcNAc:undecaprenyl-phosphate/decaprenyl-phosphate GlcNAc-1-phosphate transferase [EC:2.7.8.33 2.7.8.35]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU35530 (tagO)
   01005 Lipopolysaccharide biosynthesis proteins [BR:bsu01005]
    BSU35530 (tagO)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.33  UDP-N-acetylglucosamine---undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
     BSU35530 (tagO)
    2.7.8.35  UDP-N-acetylglucosamine---decaprenyl-phosphate N-acetylglucosaminephosphotransferase
     BSU35530 (tagO)
Glycosyltransferases [BR:bsu01003]
 Polysaccharide
  Bacterial polysaccharide
   BSU35530 (tagO)
Lipopolysaccharide biosynthesis proteins [BR:bsu01005]
 O-antigen
  BSU35530 (tagO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-GeneID: 936757
NCBI-ProteinID: NP_391433
Pasteur: BG12684
BSORF: BG12684
UniProt: O34753
Position
complement(3648654..3649730)
Genome map
AA seq 358 aa AA seqDB search
MLDERMIRIVVAFIVSLLTVLIITPIVKRIAIKIGAVDQPSNRKVHDKIMPRMGGLAIFI
GVVAGVLASGIYTETRMTAITVGAFIIIVLGILDDKYQLSAKVKFLIQLGVAIMIVSTGL
KMDFFSVPFLTERFELGWMAYPLTVLWIVGITNAINLIDGLDGLAAGLSVIGLSTIAVMA
LSGGKVLILSLSLVVIASTLGFLFYNFHPAKIFMGDTGSLFLGYSISILSLLGLYKSVTL
FSIVIPIIILGVPIFDTTFAIIRRILNKQPISAPDKSHIHHRLMAFGLSHRMSVLVIYLI
GFIFSISAIVLKSATIWLSLFIIFILIIFMQIIAEVTGLVNEKFKPFTKFYKRLVKRN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgaacgcatgattcgcattgttgttgcgtttattgtctcgctgctgacagtt
ttaatcataaccccaatcgtaaaaaggattgcgattaaaataggtgcagttgaccagccc
agcaatcgaaaagtacatgacaaaatcatgccccgcatgggcgggctggccatatttatc
ggggtggttgcaggcgtgcttgcatccggtatttacacagaaacaaggatgacggcaatt
acagtcggagcattcatcattattgtgttaggtattcttgacgataaatatcaattaagt
gcaaaagttaagtttttgattcaattaggtgtagccattatgattgtaagcactggctta
aaaatggactttttctcagtaccttttttaacagaacgatttgagttaggatggatggct
tatccgctgacggtattatggattgtcggcatcacgaacgcaattaacctgattgatgga
ttggatggccttgctgccggtctttctgttatcggcctgtcaacgattgctgtcatggcg
ctatccggcggaaaagtgctcattctgtcactctcattagtcgttattgccagcacgctg
gggtttttgttttacaacttccatccggcaaaaatctttatgggagatacgggatcactg
tttttagggtatagtatctcgattctttcattattaggcctgtataaaagtgtcacattg
ttcagtatcgttatcccgattattatattaggcgtaccgatttttgatacaacatttgct
atcatcagaagaatattaaacaaacagccgatttcagcgcctgataagtcgcatattcac
catagactgatggcctttggcctttcacatcggatgtcggtcttagttatttatttaatt
ggatttattttcagtatcagtgcgattgtacttaaaagtgccacaatttggctttctttg
tttattatcttcattttgattatttttatgcaaatcatagcagaagtgacaggactcgtg
aatgaaaaatttaagccgtttacaaagttttataaacggctggtgaaaaggaattaa

DBGET integrated database retrieval system