KEGG   Bacillus subtilis subsp. subtilis 168: BSU35540Help
Entry
BSU35540          CDS       T00010                                 

Gene name
tuaH
Definition
(RefSeq) teichuronic acid biosynthesis glycosyltransferase TuaH
  KO
K16699  teichuronic acid biosynthesis glycosyltransferase TuaH [EC:2.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU35540 (tuaH)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BSU35540 (tuaH)
Glycosyltransferases [BR:bsu01003]
 Others
  Other glycosyltransferases
   BSU35540 (tuaH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_1_4 Glycos_transf_1 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 938535
NCBI-ProteinID: NP_391434
Pasteur: BG12695
BSORF: BG12695
UniProt: O32267
Position
complement(3649875..3651068)
Genome map
AA seq 397 aa AA seqDB search
METKEAIIHVIVATAEWGKDQLRYRRHRLAEFLAAQEETKEVIWVCPAPRAQGKEFQEVH
SGIRQFAVKDLLQKKMFRFGRYTDVFYRHKLSPLLDELTPASANGERCCLWYTFPGFPLL
SSLYSWDQVIYDCSDLWAAPISGRSNLLSEFRRKVIKSAELRIIQRADSITCSSDYLHKE
VDKKLTAGREKVHTVENGVEYELFSANKQAPDRSILQGREGIVLGFIGGIKPKLDFKMIK
EAALQKPDWTFLWVGPDATNGDVSFQELLRLPNVIWTGPADPKEVPHYMELIDIGIMPYK
QSPYNQAVFPLKLFEFLAAGKPVVGTNLPSTSKMQKPYVYEYVEGDHPIDFIAACEKVLG
QNGDETYKEMRRNIARTQDWNCLFRQIMKYTGIQKHA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggaaacaaaagaagcaatcattcatgtcatcgttgccactgctgaatggggaaaagac
caattgagatacagaaggcaccggctggcagaatttttagctgctcaggaggaaacgaag
gaagttatttgggtatgtccggctccgcgtgcccaagggaaagagtttcaggaagtccat
tctggcatcaggcaattcgctgtcaaagacctgctgcagaaaaaaatgtttcgtttcgga
cgatatacagatgtcttttacagacataagctctccccattactcgatgagcttacacct
gcttctgcaaacggtgaacgctgctgtttatggtacacgtttcccggattcccgctgctg
tcttcgctgtattcttgggatcaggtcatttatgactgcagtgacctatgggctgcgccg
atcagcggccgatcaaatctgctgtctgaattccggcgaaaagtcattaaatcggcagag
ctgagaattatacaacgagcagattcaataacctgttcatcagattatcttcacaaggaa
gtagacaaaaaactgactgcaggacgagaaaaggttcatactgtggaaaacggtgtggag
tatgagctgttttctgcaaataaacaagctcccgatcgcagtatactgcaggggagagaa
ggaatagtgttaggttttattggcgggattaaaccgaagctcgattttaaaatgattaaa
gaagcggcactgcaaaagcctgattggacatttttatgggttggcccggatgccaccaat
ggtgatgtttcgtttcaagagctgctgaggcttcccaatgtcatatggaccggtccggca
gatccaaaagaagtgcctcattatatggagcttatcgacattggcattatgccatataaa
caatcaccgtataatcaagctgtgtttccgctgaaactatttgaatttttagcggcagga
aaacctgttgtaggcactaatcttccgtcaacctcaaaaatgcaaaagccgtatgtatac
gaatatgtagagggcgatcatccgattgattttatagccgcttgtgaaaaagttctcggt
caaaacggagacgagacctataaagaaatgcgccgaaacatcgcccggacacaagattgg
aattgcttatttagacaaattatgaaatatacagggattcaaaaacatgcgtag

DBGET integrated database retrieval system