KEGG   Bacillus subtilis subsp. subtilis 168: BSU35550Help
Entry
BSU35550          CDS       T00010                                 

Gene name
tuaG
Definition
(RefSeq) teichuronic acid biosynthesis glycosyltransferase TuaG
  KO
K16698  teichuronic acid biosynthesis glycosyltransferase TuaG [EC:2.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU35550 (tuaG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BSU35550 (tuaG)
Glycosyltransferases [BR:bsu01003]
 Others
  Other glycosyltransferases
   BSU35550 (tuaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4 tRNA_lig_kinase
Motif
Other DBs
NCBI-GeneID: 937965
NCBI-ProteinID: NP_391435
Pasteur: BG12694
BSORF: BG12694
UniProt: O32268
Position
complement(3651097..3651855)
Genome map
AA seq 252 aa AA seqDB search
MTNWKPLVSVITPSYNARDYIEDTVHSVLDQSHPHWEMIIVDDCSTDGTRDILQQYEKID
ERIHVVYLEENSGAAVARNKALERAQGRYVAFLDSDDKWKKDKLEKQLEFMMERSCAFSF
TGYSLMAQDGTPLDKFIHAPESLTYDDALKNTIIGCLTVMIDREQTGQIQMPNIRTRQDL
ATWLSLLKKGFTAYGMNECLAEYRLVNNSISSNKWKAAKKTWFVYREIERLHFMKATWCF
VQYAKNAVKKRL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaccaattggaaacctctcgtatctgtcattacaccttcctataatgcgcgtgactat
attgaagacacggttcattcggtattagatcagagccatcctcattgggaaatgattatc
gtggatgattgctcaacggatgggacccgcgacattttacagcagtatgaaaaaatagac
gaaagaattcatgtggtgtatctggaagagaactccggagctgcggttgctcgcaacaaa
gcgttggaacgcgctcaagggcgctacgtagcatttttggacagtgatgacaaatggaaa
aaagacaaactggaaaagcagcttgagtttatgatggagcgctcctgtgcgttctctttc
acgggctacagcttaatggcgcaggacgggaccccgctcgataaatttattcatgcgccg
gaaagcctgacgtacgatgacgccctgaaaaatacaattatcggctgcttgacggtgatg
attgacagggagcaaacgggacagatccaaatgccgaatatcagaacgagacaggactta
gccacatggctgtctcttttaaaaaaaggatttactgcctatggaatgaatgaatgcctg
gctgaatatcggcttgtcaataattcaatttccagcaacaaatggaaggctgcgaaaaaa
acgtggtttgtctacagggagatcgaacggcttcattttatgaaagcaacatggtgtttt
gttcaatatgcaaaaaacgcggtgaaaaaaagattatag

DBGET integrated database retrieval system