KEGG   Bacillus subtilis subsp. subtilis 168: BSU35570Help
Entry
BSU35570          CDS       T00010                                 

Gene name
tuaE
Definition
(RefSeq) teichuronic acid biosynthesis protein TuaE
  KO
K16705  teichuronic acid biosynthesis protein TuaE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99986 Glycan metabolism
    BSU35570 (tuaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzy_C
Motif
Other DBs
NCBI-GeneID: 936765
NCBI-ProteinID: NP_391437
Pasteur: BG12692
BSORF: BG12692
UniProt: O32270
Position
complement(3652588..3654054)
Genome map
AA seq 488 aa AA seqDB search
MSIKRSAVHTLALLAAAIFGVVLLLGAIHKDIGFMQMAAVLAVLAIGLFLLTLATAFTTK
ERLFMAVIYILIACTFLNNAFFAIHLGFFSLFLYRLLLIAAGCLHIFGMVRNRTHIERWH
GLQVKGILLFFAFWFIYGLVSLLWAKSVTVGLKYLALLAMGIFFIYLIVMYVQKMERLMI
VYAIWLVMTVFLMIIGFYNHITHHHLASSTLYSGPEYKQHYPTSVFFNQNDFATFLSISF
FFYITMMKNIKNGYIKAIGLVLSLCALYLIFATGSRASLLGIFAGIAVYIFIVLPPVLKR
MAIWLSAAGIALFAVLFASKIYSKFWELFLAPQTLHSFHDRLPSNVARANLLKNAWHFFL
DSYGFGVGAGNVSYYLEHYAVYDTDNVAEVHNWLVEILANFGLFIMLGYLSVYAYLIWVL
YKFYERKLENQSKLITEGLITAMVSFLVSSISPSSVSNLFFHWVFMALVIAAVNVLRRSR
QMPEPMYR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgagtatcaaacgatcagcggtccatacgctagcgttactggccgctgctatatttgga
gtcgtcctattgctgggagccatccataaagatataggtttcatgcagatggctgctgtg
cttgcggtgttggcaattggcctgtttttactgacgcttgcaaccgcatttacaacaaaa
gaacggctctttatggctgtaatctatattttgatcgcctgcacttttttaaataatgca
ttttttgccattcatcttggatttttcagtttgttcctttaccggcttctgctcattgca
gcgggttgccttcatattttcggcatggttcggaatcgaacccatattgaaagatggcat
gggctgcaagtaaaagggattttactctttttcgccttttggtttatatatggccttgtt
tctctgctgtgggccaagtcggtaacagttggcctcaagtatttagccttattggcaatg
gggatcttcttcatttatcttattgtcatgtacgtgcaaaaaatggagcggctgatgatt
gtttatgccatttggctggtgatgacggtatttctgatgatcattggtttttacaatcat
atcacccaccatcatcttgcgagttccacattgtacagcggaccggagtacaagcagcat
tatccgacatcggtcttttttaatcaaaatgactttgcgacctttttatccatcagcttc
tttttttacatcacgatgatgaaaaacattaagaatggatacatcaaggcaattggcctt
gtgctctcgctctgtgcgttgtatttaatttttgccactggttcaagagccagccttctg
ggcatttttgcaggtattgctgtctacatcttcattgtattgccgcctgttttaaagaga
atggctatatggctgtcggcggcgggaattgctcttttcgcagttcttttcgccagcaaa
atctattcaaagttttgggagctgtttctggccccgcagacgctgcattcatttcatgac
aggcttccatcaaatgtggctcgggcaaatctgctgaaaaacgcttggcattttttcctt
gattcatacggattcggagtcggggcaggaaatgtatcctattatcttgagcattatgct
gtatatgatactgacaatgtggcagaggtgcataactggcttgttgaaattcttgctaat
tttggtttgttcatcatgctgggatatttgtccgtttatgcctacctcatatgggtgctt
tacaagttttatgaaagaaaattagaaaatcagtcaaaactgatcacagaaggacttatt
accgctatggtcagtttcctggtatcaagtatcagcccaagctctgtttcaaatttattt
ttccattgggtgtttatggcgctcgtcatcgccgccgtgaatgtgttaaggcgatccaga
caaatgcctgagccgatgtacagataa

DBGET integrated database retrieval system