KEGG   Bacillus subtilis subsp. subtilis 168: BSU35580Help
Entry
BSU35580          CDS       T00010                                 

Gene name
tuaD
Definition
(RefSeq) UDP-glucose 6-dehydrogenase TuaD
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00053  Ascorbate and aldarate metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU35580 (tuaD)
   00053 Ascorbate and aldarate metabolism
    BSU35580 (tuaD)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU35580 (tuaD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     BSU35580 (tuaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh UDPG_MGDP_dh_C 3HCDH_N NAD_Gly3P_dh_N Pyr_redox AlaDh_PNT_C DUF1919
Motif
Other DBs
NCBI-GeneID: 936766
NCBI-ProteinID: NP_391438
Pasteur: BG12691
BSORF: BG12691
UniProt: O32271
Position
complement(3654139..3655524)
Genome map
AA seq 461 aa AA seqDB search
MKKIAVIGTGYVGLVSGTCFAEIGNKVVCCDIDESKIRSLKNGVIPIYEPGLADLVEKNV
LDQRLTFTNDIPSAIRASDIIYIAVGTPMSKTGEADLTYVKAAAKTIGEHLNGYKVIVNK
STVPVGTGKLVQSIVQKASKGRYSFDVVSNPEFLREGSAIHDTMNMERAVIGSTSHKAAA
IIEELHQPFHAPVIKTNLESAEMIKYAANAFLATKISFINDIANICERVGADVSKVADGV
GLDSRIGRKFLKAGIGFGGSCFPKDTTALLQIAKSAGYPFKLIEAVIETNEKQRVHIVDK
LLTVMGSVKGRTISVLGLAFKPNTNDVRSAPALDIIPMLQQLGAHVKAYDPIAIPEASAI
LGEQVEYYTDVYAAMEDTDACLILTDWPEVKEMELVKVKTLLKQPVIIDGRNLFSLEEMQ
AAGYIYHSIGRPAVRGTEPSDKYFPGLPLEELAKDLGSVNL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaatagctgtcattggaacaggttatgtaggactcgtatcaggcacttgcttt
gcggagatcggcaataaagttgtttgctgtgatatcgatgaatcaaaaatcagaagcctg
aaaaatggggtaatcccaatctatgaaccagggcttgcagacttagttgaaaaaaatgtg
ctggatcagcgcctgacctttacgaacgatatcccgtctgccattcgggcctcagatatt
atttatattgcagtcggaacgcctatgtccaaaacaggtgaagctgatttaacgtacgtc
aaagcggcggcgaaaacaatcggtgagcatcttaacggctacaaagtgatcgtaaataaa
agcacagtcccggttggaacagggaaactggtgcaatctatcgttcaaaaagcctcaaag
gggagatactcatttgatgttgtatctaaccctgaattccttcgggaagggtcagcgatt
catgacacgatgaatatggagcgtgccgtgattggttcaacaagtcataaagccgctgcc
atcattgaggaacttcatcagccattccatgctcctgtcattaaaacaaacctagaaagt
gcagaaatgattaaatacgccgcgaatgcatttctggcgacaaagatttcctttatcaac
gatatcgcaaacatttgtgagcgagtcggcgcagacgtttcaaaagttgctgatggtgtt
ggtcttgacagccgtatcggcagaaagttccttaaagctggtattggattcggcggttca
tgttttccaaaggatacaaccgcgctgcttcaaatcgcaaaatcggcaggctatccattc
aagctcatcgaagctgtcattgaaacgaacgaaaagcagcgtgttcatattgtagataaa
cttttgactgttatgggaagcgtcaaagggagaaccatttcagtcctgggattagccttc
aaaccgaatacgaacgatgtgagatccgctccagcgcttgatattatcccaatgctgcag
cagctgggcgcccatgtaaaagcatacgatccgattgctattcctgaagcttcagcgatc
cttggcgaacaggtcgagtattacacagatgtgtatgctgcgatggaagacactgatgca
tgcctgattttaacggattggccggaagtgaaagaaatggagcttgtaaaagtgaaaacc
ctcttaaaacagccagtcatcattgacggcagaaatttattttcacttgaagagatgcag
gcagccggatacatttatcactctatcggccgtcccgctgttcggggaacggaaccctct
gacaagtattttccgggcttgccgcttgaagaattggctaaagacttgggaagcgtcaat
ttataa

DBGET integrated database retrieval system