KEGG   Bacillus subtilis subsp. subtilis 168: BSU35580
Entry
BSU35580          CDS       T00010                                 

Symbol
tuaD
Name
(RefSeq) UDP-glucose 6-dehydrogenase TuaD
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00053  Ascorbate and aldarate metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
bsu01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU35580 (tuaD)
   00053 Ascorbate and aldarate metabolism
    BSU35580 (tuaD)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU35580 (tuaD)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU35580 (tuaD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     BSU35580 (tuaD)
SSDB
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh UDPG_MGDP_dh_C 3HCDH_N NAD_Gly3P_dh_N Pyr_redox AlaDh_PNT_C
Other DBs
NCBI-GeneID: 936766
NCBI-ProteinID: NP_391438
Pasteur: BG12691
BSORF: BG12691
UniProt: O32271 A0A6M4JPR2
Position
complement(3654139..3655524)
AA seq 461 aa
MKKIAVIGTGYVGLVSGTCFAEIGNKVVCCDIDESKIRSLKNGVIPIYEPGLADLVEKNV
LDQRLTFTNDIPSAIRASDIIYIAVGTPMSKTGEADLTYVKAAAKTIGEHLNGYKVIVNK
STVPVGTGKLVQSIVQKASKGRYSFDVVSNPEFLREGSAIHDTMNMERAVIGSTSHKAAA
IIEELHQPFHAPVIKTNLESAEMIKYAANAFLATKISFINDIANICERVGADVSKVADGV
GLDSRIGRKFLKAGIGFGGSCFPKDTTALLQIAKSAGYPFKLIEAVIETNEKQRVHIVDK
LLTVMGSVKGRTISVLGLAFKPNTNDVRSAPALDIIPMLQQLGAHVKAYDPIAIPEASAI
LGEQVEYYTDVYAAMEDTDACLILTDWPEVKEMELVKVKTLLKQPVIIDGRNLFSLEEMQ
AAGYIYHSIGRPAVRGTEPSDKYFPGLPLEELAKDLGSVNL
NT seq 1386 nt   +upstreamnt  +downstreamnt
gtgaaaaaaatagctgtcattggaacaggttatgtaggactcgtatcaggcacttgcttt
gcggagatcggcaataaagttgtttgctgtgatatcgatgaatcaaaaatcagaagcctg
aaaaatggggtaatcccaatctatgaaccagggcttgcagacttagttgaaaaaaatgtg
ctggatcagcgcctgacctttacgaacgatatcccgtctgccattcgggcctcagatatt
atttatattgcagtcggaacgcctatgtccaaaacaggtgaagctgatttaacgtacgtc
aaagcggcggcgaaaacaatcggtgagcatcttaacggctacaaagtgatcgtaaataaa
agcacagtcccggttggaacagggaaactggtgcaatctatcgttcaaaaagcctcaaag
gggagatactcatttgatgttgtatctaaccctgaattccttcgggaagggtcagcgatt
catgacacgatgaatatggagcgtgccgtgattggttcaacaagtcataaagccgctgcc
atcattgaggaacttcatcagccattccatgctcctgtcattaaaacaaacctagaaagt
gcagaaatgattaaatacgccgcgaatgcatttctggcgacaaagatttcctttatcaac
gatatcgcaaacatttgtgagcgagtcggcgcagacgtttcaaaagttgctgatggtgtt
ggtcttgacagccgtatcggcagaaagttccttaaagctggtattggattcggcggttca
tgttttccaaaggatacaaccgcgctgcttcaaatcgcaaaatcggcaggctatccattc
aagctcatcgaagctgtcattgaaacgaacgaaaagcagcgtgttcatattgtagataaa
cttttgactgttatgggaagcgtcaaagggagaaccatttcagtcctgggattagccttc
aaaccgaatacgaacgatgtgagatccgctccagcgcttgatattatcccaatgctgcag
cagctgggcgcccatgtaaaagcatacgatccgattgctattcctgaagcttcagcgatc
cttggcgaacaggtcgagtattacacagatgtgtatgctgcgatggaagacactgatgca
tgcctgattttaacggattggccggaagtgaaagaaatggagcttgtaaaagtgaaaacc
ctcttaaaacagccagtcatcattgacggcagaaatttattttcacttgaagagatgcag
gcagccggatacatttatcactctatcggccgtcccgctgttcggggaacggaaccctct
gacaagtattttccgggcttgccgcttgaagaattggctaaagacttgggaagcgtcaat
ttataa

DBGET integrated database retrieval system