KEGG   Bacillus subtilis subsp. subtilis 168: BSU35590
Entry
BSU35590          CDS       T00010                                 

Symbol
tuaC
Name
(RefSeq) teichuronic acid biosynthesis glycosyltransferase TuaC
  KO
K16697  teichuronic acid biosynthesis glycosyltransferase TuaC [EC:2.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU35590 (tuaC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BSU35590 (tuaC)
Glycosyltransferases [BR:bsu01003]
 Others
  Other glycosyltransferases
   BSU35590 (tuaC)
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_4_2 Glyco_trans_1_2 Glyco_transf_5
Other DBs
NCBI-GeneID: 936771
NCBI-ProteinID: NP_391439
Pasteur: BG12690
BSORF: BG12690
UniProt: O32272 A0A6M3ZGI6
Position
complement(3655586..3656755)
AA seq 389 aa
MKILWITSVYPSSMKPGEGVFHETQVQELQKLGLDITVICPRPFHSAPVRMLKKTYRKKD
VRPEYEIRKGIPVYRPFYRAVPGQLKWAQPHRRIASAVLKTMKQRDLYPDLIHAHFAMPS
GGAAAVVSESAQIPYVLTLHGSDVNVYPHYSKGAFKAFKRAVGSASVVLAVSHKLQEEAK
KLSGFDSSVLPIGIQLSRFQGNEETKEEIRKRLGLPLDQRLAVYVGRLVREKGIFELSEA
IESLQDSPKAVFVGDGPAKSTLTQKGHIVTGQVPNHQVRDYLLAADLFVLPSYSEGMPTV
VIEALALRVPVICTDVGGVSSLFGKHQHLLIKPKSAQALAEAITRYEHEQIWKPEVADDL
YETVQAQFDAGKNAKALHHQYQTVTKTSV
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgaagattttgtggatcacaagcgtatatccgagcagtatgaaacccggagagggtgtg
tttcatgagacacaggtgcaagagctgcaaaaactcgggcttgatatcactgtgatatgc
ccacggccttttcattcagcacctgtccgcatgctgaaaaagacatatcgaaaaaaggat
gtcagaccggagtatgagattagaaaggggataccggtttaccggcctttctatcgggca
gttcccggccagctgaagtgggcgcagcctcatcggagaatcgcatcagccgttttaaaa
acaatgaaacagcgcgacctatatccggatctgatccatgcgcattttgccatgccatcg
ggcggggctgcggcagtcgtgtcagagtcagcgcaaattccttatgtcctgaccttgcat
ggcagtgatgtgaatgtctatccgcattacagcaaaggtgcgtttaaagccttcaagcgt
gccgtaggttctgcgtcagttgttttagcagtcagccacaagcttcaggaagaagccaaa
aagctttcgggctttgacagctcggttttgccaatcggcatacagctcagccgttttcag
gggaatgaggagacgaaagaggaaatcagaaaaagactcggactcccgctcgatcagcgt
ctggctgtctatgtcggccggctggtcagagagaaaggcatttttgaactgtctgaagcg
atcgaatcgctgcaggactctcctaaggcagtctttgtcggggatggtcccgcaaaatcg
acgctgacgcagaaggggcatatcgtcacaggccaagtcccgaatcatcaggtaagagac
tatttacttgcggcagatctattcgtacttccttcttacagtgaggggatgccgactgtt
gtgattgaggcgctggcgctaagggttcctgttatttgtacggatgttggcggagtgtcg
tctttattcggaaagcaccaacatctgctgattaaaccgaaatccgctcaagccttggcg
gaagcgatcactcggtacgaacatgagcaaatatggaagccggaagtagcagatgacttg
tatgaaaccgtgcaggctcaatttgacgcaggaaaaaacgccaaggccttgcatcatcag
tatcagacggtcacgaaaacgtccgtttaa

DBGET integrated database retrieval system