KEGG   Bacillus subtilis subsp. subtilis 168: BSU35600
Entry
BSU35600          CDS       T00010                                 

Symbol
tuaB
Name
(RefSeq) teichuronic acid biosynthesis protein TuaB
  KO
K16694  teichuronic acid exporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU35600 (tuaB)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU35600 (tuaB)
SSDB
Motif
Pfam: Polysacc_synt Polysacc_synt_3 Polysacc_synt_C
Other DBs
NCBI-GeneID: 936770
NCBI-ProteinID: NP_391440
Pasteur: BG12689
BSORF: BG12689
UniProt: O32273 A0A6M4JRR6
Position
complement(3656752..3658203)
AA seq 483 aa
MPSITKQIMSGAKWTSISTMCITIIQIVQFALLGNMMTLTEFGLVGMITTVTVFAQIVLD
MGFGAALIQRDDATERQLSTLYWLNIMTGVLLFVLLYVSSPVIAGFYQREELVFLVRILA
IMFLIAPIGQQYQYMLQKQLHFNTLSKIEIFSNVLSFGYLAIAVFMMDAILAYVISQVLL
QSSKGILYWAVYRKKWHPAFVFDLRGMKDFFSFGAFQLSSRLVNRLGANIDMILIGRFIG
AEALGIYNLAYQIVTIPVLKINPIVTRVAFPIFAKNKYENSVIREGFLNMTKMLALVSFP
LLIGLVSVSDAFITAVFGEKWLAAVPILNVLAIVGILRVLMNPNGSVLLAKGRADLAFYW
DSGVLLLYGLSLFAAVQTGSLLTVAWVYAIISVVNFLIGRWLLAYVIKLNLSAYFQSIMK
PFLITAAMGIIAFGVSLSTEHFSMQAEMRLAISVAAGALCYLFLLVKAYPQTKSKLLRKG
RLS
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgccaagtattacaaaacaaatcatgagcggtgcaaagtggacaagtatttcaaccatg
tgtattacaatcatacaaattgttcagtttgccctgcttggaaatatgatgaccttaaca
gaatttgggcttgtcggcatgatcacaacggttacagttttcgcccagattgtgctcgat
atgggttttggcgcagcattaattcagagagacgacgcgacggagcgccagctgtcaaca
ttgtattggcttaacattatgacgggcgttttgctgtttgttcttttatatgtgagcagt
cctgtcattgcgggattttatcaaagagaagagctggtgtttctggttcggattctggcg
attatgtttttgatcgcgccaattggacagcaatatcagtatatgctgcaaaagcagctg
cattttaatacgttaagcaaaatagagattttttcaaatgtattgtcattcggatattta
gcgatagcggtttttatgatggatgcgattttggcgtacgtgatttctcaagtcctgctg
cagtccagtaaagggattttatattgggctgtataccgaaaaaagtggcatcctgctttt
gtttttgatttgagaggcatgaaggatttcttttcttttggagcctttcagctttcatcc
cgtcttgtgaacaggctgggagcaaatatcgacatgattttgatcggccggtttattggt
gctgaagcattggggatttataacctcgcttatcagattgtcaccattccggttttgaag
atcaatccgattgtcacacgggtggcattccctattttcgcaaaaaacaaatatgaaaac
agcgtgatcagagaaggctttctgaatatgacaaaaatgctggcgcttgtttcgtttccg
ctgttaatcgggctcgtgtctgtgtcagacgcctttatcacagcggttttcggagaaaaa
tggcttgctgctgttccgatcctaaatgttcttgcgattgtcggaatactaagagtgctc
atgaatccaaatggatctgtgttgctggctaaaggaagagctgacttagcgttttattgg
gattccggcgtgctgctgctgtacggattatcactgtttgcagctgtacagacgggaagc
ctgctgacagtcgcatgggtgtatgccattatcagcgttgttaatttcctgattgggcgc
tggcttttggcatatgtcatcaagcttaacctttcagcttatttccagtcgattatgaag
ccatttctgattactgcggcgatgggcatcatcgcgtttggtgtaagcctcagtaccgaa
cacttcagtatgcaggcagaaatgcggctggccatttcagttgcggctggggcgctgtgc
tatctctttcttttggtaaaagcgtaccctcaaacgaaaagcaaactactaagaaaagga
cgtttgtcatga

DBGET integrated database retrieval system