KEGG   Bacillus subtilis subsp. subtilis 168: BSU35600Help
Entry
BSU35600          CDS       T00010                                 

Gene name
tuaB
Definition
(RefSeq) teichuronic acid biosynthesis protein TuaB
  KO
K16694  teichuronic acid exporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU35600 (tuaB)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU35600 (tuaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_3 Polysacc_synt_C
Motif
Other DBs
NCBI-GeneID: 936770
NCBI-ProteinID: NP_391440
Pasteur: BG12689
BSORF: BG12689
UniProt: O32273
Position
complement(3656752..3658203)
Genome map
AA seq 483 aa AA seqDB search
MPSITKQIMSGAKWTSISTMCITIIQIVQFALLGNMMTLTEFGLVGMITTVTVFAQIVLD
MGFGAALIQRDDATERQLSTLYWLNIMTGVLLFVLLYVSSPVIAGFYQREELVFLVRILA
IMFLIAPIGQQYQYMLQKQLHFNTLSKIEIFSNVLSFGYLAIAVFMMDAILAYVISQVLL
QSSKGILYWAVYRKKWHPAFVFDLRGMKDFFSFGAFQLSSRLVNRLGANIDMILIGRFIG
AEALGIYNLAYQIVTIPVLKINPIVTRVAFPIFAKNKYENSVIREGFLNMTKMLALVSFP
LLIGLVSVSDAFITAVFGEKWLAAVPILNVLAIVGILRVLMNPNGSVLLAKGRADLAFYW
DSGVLLLYGLSLFAAVQTGSLLTVAWVYAIISVVNFLIGRWLLAYVIKLNLSAYFQSIMK
PFLITAAMGIIAFGVSLSTEHFSMQAEMRLAISVAAGALCYLFLLVKAYPQTKSKLLRKG
RLS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgccaagtattacaaaacaaatcatgagcggtgcaaagtggacaagtatttcaaccatg
tgtattacaatcatacaaattgttcagtttgccctgcttggaaatatgatgaccttaaca
gaatttgggcttgtcggcatgatcacaacggttacagttttcgcccagattgtgctcgat
atgggttttggcgcagcattaattcagagagacgacgcgacggagcgccagctgtcaaca
ttgtattggcttaacattatgacgggcgttttgctgtttgttcttttatatgtgagcagt
cctgtcattgcgggattttatcaaagagaagagctggtgtttctggttcggattctggcg
attatgtttttgatcgcgccaattggacagcaatatcagtatatgctgcaaaagcagctg
cattttaatacgttaagcaaaatagagattttttcaaatgtattgtcattcggatattta
gcgatagcggtttttatgatggatgcgattttggcgtacgtgatttctcaagtcctgctg
cagtccagtaaagggattttatattgggctgtataccgaaaaaagtggcatcctgctttt
gtttttgatttgagaggcatgaaggatttcttttcttttggagcctttcagctttcatcc
cgtcttgtgaacaggctgggagcaaatatcgacatgattttgatcggccggtttattggt
gctgaagcattggggatttataacctcgcttatcagattgtcaccattccggttttgaag
atcaatccgattgtcacacgggtggcattccctattttcgcaaaaaacaaatatgaaaac
agcgtgatcagagaaggctttctgaatatgacaaaaatgctggcgcttgtttcgtttccg
ctgttaatcgggctcgtgtctgtgtcagacgcctttatcacagcggttttcggagaaaaa
tggcttgctgctgttccgatcctaaatgttcttgcgattgtcggaatactaagagtgctc
atgaatccaaatggatctgtgttgctggctaaaggaagagctgacttagcgttttattgg
gattccggcgtgctgctgctgtacggattatcactgtttgcagctgtacagacgggaagc
ctgctgacagtcgcatgggtgtatgccattatcagcgttgttaatttcctgattgggcgc
tggcttttggcatatgtcatcaagcttaacctttcagcttatttccagtcgattatgaag
ccatttctgattactgcggcgatgggcatcatcgcgtttggtgtaagcctcagtaccgaa
cacttcagtatgcaggcagaaatgcggctggccatttcagttgcggctggggcgctgtgc
tatctctttcttttggtaaaagcgtaccctcaaacgaaaagcaaactactaagaaaagga
cgtttgtcatga

DBGET integrated database retrieval system