KEGG   Bacillus subtilis subsp. subtilis 168: BSU35620Help
Entry
BSU35620          CDS       T00010                                 

Gene name
lytC
Definition
(RefSeq) N-acetylmuramoyl-L-alanine amidase LytC
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BSU35620 (lytC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU35620 (lytC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU35620 (lytC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BSU35620 (lytC)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   BSU35620 (lytC)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BSU35620 (lytC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 CW_binding_2 DUF2325
Motif
Other DBs
NCBI-GeneID: 936777
NCBI-ProteinID: NP_391442
Pasteur: BG10407
BSORF: BG10407
UniProt: Q02114
Position
complement(3659119..3660609)
Genome map
AA seq 496 aa AA seqDB search
MRSYIKVLTMCFLGLILFVPTALADNSVKRVGGSNRYGTAVQISKQMYSTASTAVIVGGS
SYADAISAAPLAYQKNAPLLYTNSDKLSYETKTRLKEMQTKNVIIVGGTPAVSSNTANQI
KSLGISIKRIAGSNRYDTAARVAKAMGATSKAVILNGFLYADAPAVIPYAAKNGYPILFT
NKTSINSATTSVIKDKGISSTVVVGGTGSISNTVYNKLPSPTRISGSNRYELAANIVQKL
NLSTSTVYVSNGFSYPDSIAGATLAAKKKQSLILTNGENLSTGARKIIGSKNMSNFMIIG
NTPAVSTKVANQLKNPVVGETIFIDPGHGDQDSGAIGNGLLEKEVNLDIAKRVNTKLNAS
GALPVLSRSNDTFYSLQERVNKAASAQADLFLSIHANANDSSSPNGSETYYDTTYQAANS
KRLAEQIQPKLAANLGTRDRGVKTAAFYVIKYSKMPSVLVETAFITNASDASKLKQAVYK
DKAAQAIHDGTVSYYR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
ttgcgttcttatataaaagtcctaacaatgtgttttctggggctcatactttttgtgcca
acagctttggccgataactcagtgaaaagagttgggggaagcaatagatacggcactgct
gtacaaatatcaaagcaaatgtattcaacagcaagtacagctgtaattgttggtgggagt
tcctatgcagatgctatttcagcagcacctcttgcttaccagaagaatgcgccattgctt
tacactaattctgataagctttcatatgaaacgaaaacaagattgaaagagatgcagact
aaaaatgtaattattgtaggcggaacacctgctgtttcttctaacactgctaaccagatt
aaaagcttggggataagtattaaacgaattgcaggaagcaaccgttatgatacggctgca
cgggtggcaaaagcgatgggtgcgacttcaaaagctgttattttgaacggcttcttatat
gcagacgctccggccgtcatcccttatgcagcgaaaaacgggtatccaattctttttaca
aataaaacatctataaatagtgcgactacgtctgtgataaaagataagggaatttcgagt
accgttgttgtaggaggcactggaagtatcagcaatacggtatacaacaagttaccttct
cctacaagaattagcggttcaaacagatatgagcttgctgcaaatatcgtacaaaaactt
aatttatcaacaagcaccgtatatgtaagcaatggattcagctaccctgactctattgca
ggagctacactggcagctaagaagaagcaatctcttattcttacaaatggtgaaaattta
tctacaggagcccgtaaaattattggaagtaaaaacatgtcaaactttatgattatcgga
aacactcctgccgtaagcacaaaggttgctaatcagctaaagaatccagttgtaggtgaa
acaatctttattgatccgggtcacggtgatcaagattcaggagcaatcggcaatggactc
cttgagaaagaagtcaaccttgatatagcgaaaagagtcaatacaaagctaaatgcttca
ggtgctcttccagtactgtcaagatctaatgatactttttattctttacaggagagagta
aataaagcagcttctgcacaagcagatttatttctcagtatacatgcaaatgctaatgat
agctcatcaccaaatggaagtgagacgtactacgatacaacatatcaagctgcaaatagc
aagagactggctgaacaaattcaaccaaagttagcggctaatcttggaacgagagaccgg
ggagtaaaaacagctgctttctatgttattaaatattctaaaatgccgagtgttttagtt
gaaactgcctttatcactaatgcatcagatgcaagtaaattgaagcaagcggtttataaa
gataaagctgcacaagctattcatgacggcacagtatcttattacagataa

DBGET integrated database retrieval system