KEGG   Bacillus subtilis subsp. subtilis 168: BSU35630Help
Entry
BSU35630          CDS       T00010                                 

Gene name
lytB
Definition
(RefSeq) amidase enhancer
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CW_binding_2 SpoIID DUF2325 Filo_VP35
Motif
Other DBs
NCBI-GeneID: 936795
NCBI-ProteinID: NP_391443
Pasteur: BG10406
BSORF: BG10406
UniProt: Q02113
Position
complement(3660648..3662765)
Genome map
AA seq 705 aa AA seqDB search
MKSCKQLIVCSLAAILLLIPSVSFAADSNISVKLLNYIGNKSSISLSPTGFYKVTGDNVA
VTDRFAGASRYETATLASNSQWKNPNTVILVNRDIFIDALPVIPLAKKLNAPVLFTQPDT
LTKTTERQIAKFNPDNILIIGGARSISKDVENKLKSYGAVKRISGKNRYVLSENIAKQMG
SYDKAIVVTGRVFQDALAIAPYAAAHGYPILLTEKDKLPDYDLPKQVIIIGSSFSVSDSV
ENQIKKTSTVQRIPGSTRYELTANIIKQLKLKADKVVMTNGTKYADVLIGASLASKKNSQ
ILFVKQDSVPAAAKSITKDKATYAYDFIGSTSSISAEVENSLADEFYLADGGTYNLKINS
GKLNLENIKTYGNSLRIKPENYSTSNRISLDGKQYLGTVNFSIESTKYIRPVNENIPFED
YLKGVIPNEMPASWSLEALKAQTVAARTYSITKTGTTVPDTTAFQVYGGYSWNSNTNKAV
EQTKGKVLKYNGSLITAAYSSSNGGYTEASNEVWSSSVPYLIAKKDTKDPQIGWTLTLSK
QQLDTKSLDLTKPSSWWSSATETDSARLSGVKNWILKNKETSADSVKIASIDDLSFSGTT
QGQRAKTASMKVKYFVKSSTGSYNLSKITTISVPTSELRTMIGATVFKSTYVTVKKDTSK
YTISGKGYGHGIGMSQYGAKARAEAGDSYSSILKFYYPGTTLTSY
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcttgcaaacaattgatagtgtgttcacttgctgcaatcttattattgattcca
tcagtttcttttgcagcagactcaaacatctcagttaaattgttaaattatattggaaat
aaatctagcatcagtctatcgccaacaggattttataaagtaactggagataatgttgct
gttacggatcgttttgcaggcgcttcacgatacgaaactgcgactcttgcatccaacagc
cagtggaaaaatcctaatacagtgatattggtgaaccgagatatttttattgatgcattg
cctgttattccattggcgaaaaaactgaacgcaccagttttatttactcagcctgacacg
ttaacaaaaactactgaaagacaaattgctaagtttaaccctgataatattttaatcatt
gggggagcgcgaagcatttcaaaagacgtagaaaacaagctgaaatcatatggcgctgtg
aaaaggataagcggaaaaaatagatatgtcttatcagaaaatattgcaaagcaaatgggc
agctatgataaagcgatcgttgtaaccggaagagtatttcaagacgctttagccattgct
ccatatgcagcagcacacggataccctattttgcttacagagaaagacaagcttccggat
tatgatttgccaaaacaagtcatcattataggcagttcatttagcgtcagtgatagtgta
gaaaaccaaattaaaaaaacttcaactgtgcaaaggattcctggatcaaccagatatgaa
cttacggcaaatataattaagcaactaaagttgaaggctgataaagtcgtaatgacgaac
gggacaaaatatgcagacgtattgataggcgcttcgcttgcctcgaagaaaaacagccaa
attttatttgttaaacaagatagcgttccggctgcggctaaaagtataacgaaagataaa
gccacatatgcatacgactttattggaagtaccagttcaatttctgctgaagttgagaat
tcacttgctgatgaattttatttagctgacggtggcacctataatctaaaaatcaacagc
ggaaaattaaaccttgaaaacatcaaaacttacggaaactccctaagaattaaaccagaa
aactattctacttcaaacagaattagtcttgatggaaagcagtatcttggcacggttaat
ttctctattgagtctactaaatatatccgaccggtaaatgagaatattccatttgaggat
tacttaaaaggagtaattccgaatgaaatgcctgctagctggtcacttgaggctcttaaa
gcacagactgtcgctgcaagaacctactcaataacaaaaacaggaactactgtacctgat
acaaccgcttttcaagtttatggtggctacagttggaattcgaataccaataaagcggta
gagcaaacgaaggggaaagttctgaaatataatggatctcttataactgcagcttattct
tccagtaatggtggttacacagaagctagtaatgaagtgtggtcgtcaagtgtaccttac
ttgattgcaaaaaaagatacaaaggatcctcaaataggctggacgcttactttgtcaaaa
caacagctagatacgaaatctttggacttaacgaagccttcttcttggtggtcttcagcg
actgaaactgattctgcaagactttccggagttaagaactggatcttgaaaaataaagaa
acaagcgctgattctgtcaaaattgcaagtattgacgatttaagctttagtggaacgaca
caagggcagcgtgcaaaaacagcatcgatgaaagtgaagtattttgttaaaagcagtact
ggctcctataacttgagcaaaattacaaccattagtgtaccaacaagtgagttaagaaca
atgattggagcgactgtatttaaaagtacttatgtgactgtaaaaaaagatacttcaaag
tacacaatcagcggtaaaggatatggtcacgggatcggaatgagtcaatatggagcaaaa
gcaagagcagaagctggagattcatatagttcaattttgaaattttactatccaggtaca
actctgacaagttattga

DBGET integrated database retrieval system