KEGG   Bacillus subtilis subsp. subtilis 168: BSU35640Help
Entry
BSU35640          CDS       T00010                                 

Gene name
lytA
Definition
(RefSeq) membrane-bound protein LytA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPAM_1 CusF_Ec Lysis_col RNA_pol_RpbG PPC MAGP LPAM_2
Motif
Other DBs
NCBI-GeneID: 936784
NCBI-ProteinID: NP_391444
Pasteur: BG10405
BSORF: BG10405
UniProt: Q02112
Position
complement(3662789..3663097)
Genome map
AA seq 102 aa AA seqDB search
MKKFIALLFFILLLSGCGVNSQKSQGEDVSPDSNIETKEGTYVGLADTHTIEVTVDNEPV
SLDITEESTSDLDKFNSGDKVTITYEKNDEGQLLLKDIERAN
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttattgctttactgttctttatattgcttctttcgggttgcggggttaat
agtcaaaagagtcaaggtgaagatgtatcgccagacagtaacattgaaacaaaagaaggt
acttatgtagggttagctgatactcatacaatagaagtaacagtagataatgagccggtt
agtcttgatatcactgaagaatcgacaagtgatcttgataagtttaacagtggagataag
gtcacgattacatatgaaaaaaatgatgagggtcagcttctgttaaaagatattgaacgt
gccaactaa

DBGET integrated database retrieval system