KEGG   Bacillus subtilis subsp. subtilis 168: BSU35650
Entry
BSU35650          CDS       T00010                                 

Symbol
lytR
Name
(RefSeq) transcriptional regulator LytR
  KO
K01005  polyisoprenyl-teichoic acid--peptidoglycan teichoic acid transferase [EC:2.7.8.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU35650 (lytR)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     BSU35650 (lytR)
SSDB
Motif
Pfam: LytR_cpsA_psr DUF5882 ETRAMP DUF4179
Other DBs
NCBI-GeneID: 936787
NCBI-ProteinID: NP_391445
Pasteur: BG10404
BSORF: BG10404
UniProt: Q02115
Structure
Position
3663281..3664201
AA seq 306 aa
MRNERRKKKKTLLLTILTIIGLLVLGTGGYAYYLWHKAASTVASIHESIDKSKKRDKEVS
INKKDPFSVLIMGVDERDGDKGRADTLIYMTVNPKTNTTDMVSIPRDTYTKIIGKGTMDK
INHSYAFGGTQMTVDTVENFLDVPVDYFVKVNMESFRDVVDTLGGITVNSTFAFSYDGYS
FGKGEITLNGKEALAYTRMRKEDPRGDFGRQDRQRQVIQGIINKGANISSITKFGDMFKV
VENNVKTNLTFDNMWDIQSDYKGARKHIKQHELKGTGTKINGIYYYQADESALSDITKEL
KESLEK
NT seq 921 nt   +upstreamnt  +downstreamnt
atgagaaacgaacgcagaaaaaagaaaaaaactttattactgacaattttaacgataatc
ggacttcttgtactcggaactggcggctatgcatactacttatggcataaagcagcttca
accgtggcaagtattcatgaaagcattgataaatctaaaaagagggataaagaggtcagt
atcaataaaaaagatcctttttccgtcttaatcatgggtgtggatgaacgcgacggcgat
aagggccgtgccgatacgctcatttatatgaccgttaacccaaaaacgaatacaaccgac
atggtcagcattccgcgtgacacgtatacaaaaattatcggaaaaggcacaatggataaa
atcaaccattcatacgctttcggcggcacacagatgacggtagacactgttgagaacttc
ctcgatgttccggttgattattttgtgaaagtgaacatggaaagctttagagacgttgtt
gatacacttggcggcattacagttaacagcacattcgcgttcagttatgacggttattcg
ttcggcaaaggagaaatcacgctgaacggaaaagaagcgctcgcttatacccggatgaga
aaagaagatccgagaggcgacttcggacgccaggaccgccagcgccaagtcatccaaggt
attattaataaaggcgctaatatttcttccatcacgaaattcggagatatgtttaaagtt
gttgaaaataatgtgaaaacgaacttgaccttcgataacatgtgggatatccagtccgat
tacaaaggtgcgcggaaacatattaaacagcacgaactaaaaggtacaggcacgaaaatc
aatggaatttactactaccaagctgatgaaagcgccctttccgatattacaaaagagctg
aaggaaagcctcgaaaagtaa

DBGET integrated database retrieval system