KEGG   Bacillus subtilis subsp. subtilis 168: BSU35650Help
Entry
BSU35650          CDS       T00010                                 

Gene name
lytR
Definition
(RefSeq) transcriptional regulator LytR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytR_cpsA_psr ETRAMP DUF3285 DUF4179
Motif
Other DBs
NCBI-GeneID: 936787
NCBI-ProteinID: NP_391445
Pasteur: BG10404
BSORF: BG10404
UniProt: Q02115
Position
3663281..3664201
Genome map
AA seq 306 aa AA seqDB search
MRNERRKKKKTLLLTILTIIGLLVLGTGGYAYYLWHKAASTVASIHESIDKSKKRDKEVS
INKKDPFSVLIMGVDERDGDKGRADTLIYMTVNPKTNTTDMVSIPRDTYTKIIGKGTMDK
INHSYAFGGTQMTVDTVENFLDVPVDYFVKVNMESFRDVVDTLGGITVNSTFAFSYDGYS
FGKGEITLNGKEALAYTRMRKEDPRGDFGRQDRQRQVIQGIINKGANISSITKFGDMFKV
VENNVKTNLTFDNMWDIQSDYKGARKHIKQHELKGTGTKINGIYYYQADESALSDITKEL
KESLEK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacgaacgcagaaaaaagaaaaaaactttattactgacaattttaacgataatc
ggacttcttgtactcggaactggcggctatgcatactacttatggcataaagcagcttca
accgtggcaagtattcatgaaagcattgataaatctaaaaagagggataaagaggtcagt
atcaataaaaaagatcctttttccgtcttaatcatgggtgtggatgaacgcgacggcgat
aagggccgtgccgatacgctcatttatatgaccgttaacccaaaaacgaatacaaccgac
atggtcagcattccgcgtgacacgtatacaaaaattatcggaaaaggcacaatggataaa
atcaaccattcatacgctttcggcggcacacagatgacggtagacactgttgagaacttc
ctcgatgttccggttgattattttgtgaaagtgaacatggaaagctttagagacgttgtt
gatacacttggcggcattacagttaacagcacattcgcgttcagttatgacggttattcg
ttcggcaaaggagaaatcacgctgaacggaaaagaagcgctcgcttatacccggatgaga
aaagaagatccgagaggcgacttcggacgccaggaccgccagcgccaagtcatccaaggt
attattaataaaggcgctaatatttcttccatcacgaaattcggagatatgtttaaagtt
gttgaaaataatgtgaaaacgaacttgaccttcgataacatgtgggatatccagtccgat
tacaaaggtgcgcggaaacatattaaacagcacgaactaaaaggtacaggcacgaaaatc
aatggaatttactactaccaagctgatgaaagcgccctttccgatattacaaaagagctg
aaggaaagcctcgaaaagtaa

DBGET integrated database retrieval system