KEGG   Bacillus subtilis subsp. subtilis 168: BSU35660Help
Entry
BSU35660          CDS       T00010                                 

Gene name
mnaA
Definition
(RefSeq) UDP-N-acetylglucosamine 2-epimerase
  KO
K01791  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing) [EC:5.1.3.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU35660 (mnaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bsu01005]
    BSU35660 (mnaA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.14  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing)
     BSU35660 (mnaA)
Lipopolysaccharide biosynthesis proteins [BR:bsu01005]
 Unusual sugar
  BSU35660 (mnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase_2 Glyco_trans_4_2 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 936209
NCBI-ProteinID: NP_391446
Pasteur: BG10403
BSORF: BG10403
UniProt: P39131
Structure
PDB: 

Position
complement(3664241..3665383)
Genome map
AA seq 380 aa AA seqDB search
MKKLKVMTVFGTRPEAIKMAPLVLELKKYPEIDSYVTVTAQHRQMLDQVLDAFHIKPDFD
LNIMKERQTLAEITSNALVRLDELFKDIKPDIVLVHGDTTTTFAGSLAAFYHQIAVGHVE
AGLRTGNKYSPFPEELNRQMTGAIADLHFAPTGQAKDNLLKENKKADSIFVTGNTAIDAL
NTTVRDGYSHPVLDQVGEDKMILLTAHRRENLGEPMENMFKAIRRIVGEFEDVQVVYPVH
LNPVVREAAHKHFGDSDRVHLIEPLEVIDFHNFAAKSHFILTDSGGVQEEAPSLGKPVLV
LRDTTERPEGVEAGTLKLAGTDEENIYQLAKQLLTDPDEYKKMSQASNPYGDGEASRRIV
EELLFHYGYRKEQPDSFTGK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactaaaagtgatgaccgttttcgggaccaggcctgaagcgatcaagatggca
ccgcttgtgcttgaattgaaaaaatatcctgaaatagattcctatgtaacggtaactgca
cagcacagacagatgctcgatcaggtgttagatgcgtttcacatcaagcctgacttcgat
ttgaacattatgaaggagcggcagacactggcagagattacgtctaacgcacttgtaaga
ttggatgagttgtttaaagatatcaaacccgatattgtgcttgtccatggtgatacgacg
acgacgtttgccggaagcctagccgctttttaccatcaaattgctgtcggtcatgtggag
gcggggctccgtacagggaataagtattccccgtttccggaagagctcaatcgacagatg
acaggggcgattgctgatttgcattttgctccgacaggccaggcgaaagacaatttatta
aaagaaaacaaaaaggccgactctatttttgtaacgggcaatacagcgattgacgcactc
aacacaacggttagggatggttactcacatcctgttctcgatcaggtgggtgaggataaa
atgattctcttgaccgctcaccgccgggaaaatttgggtgagccaatggaaaacatgttt
aaggccatccgcagaattgtaggggaatttgaagatgtacaagtcgtttaccctgtgcac
ctgaatcctgttgtccgggaagcggctcataagcattttggtgattctgacagagtgcat
ctgattgaacctttagaggtgatcgatttccataactttgcagcgaaatcgcattttata
ttgaccgattcgggcggcgtgcaggaggaagccccatctctcgggaaaccggttcttgtt
ctgcgtgatacgacggaacggcctgaaggagtggaagcgggaacgctgaaacttgcaggt
acggatgaggaaaacatttatcagcttgcaaaacagctgttaactgatcctgatgagtac
aagaaaatgtcccaggcttctaatccgtatggagatggagaggcttcccgccggattgtg
gaagaattgctgtttcattacgggtatcgaaaagaacaaccggattcatttacaggcaaa
taa

DBGET integrated database retrieval system