KEGG   Bacillus subtilis subsp. subtilis 168: BSU35670Help
Entry
BSU35670          CDS       T00010                                 

Gene name
gtaB
Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00052  Galactose metabolism
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01130  Biosynthesis of antibiotics
Module
bsu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
bsu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU35670 (gtaB)
   00052 Galactose metabolism
    BSU35670 (gtaB)
   00500 Starch and sucrose metabolism
    BSU35670 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU35670 (gtaB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BSU35670 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 936797
NCBI-ProteinID: NP_391447
Pasteur: BG10402
BSORF: BG10402
UniProt: Q05852
Position
3665629..3666507
Genome map
AA seq 292 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKS
KRAIEDHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEG
RRYQVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAIQKLNEI
QRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGLLNKEEI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacgtaaagccataattccagcagcaggcttaggaacacgttttcttccg
gctacgaaagcaatgccgaaagaaatgcttcctatcgttgataaacctaccattcaatac
ataattgaagaagctgttgaagccggtattgaagatattattatcgtaacaggaaaaagc
aagcgtgcgattgaggatcattttgattactctcctgagcttgaaagaaacctagaagaa
aaaggaaaaactgagctgcttgaaaaagtgaaaaaggcttctaacctggctgacattcac
tatatccgccaaaaagaacctaaaggtctcggacatgctgtctggtgcgcacgcaacttt
atcggcgatgagccgtttgcggtactgcttggtgacgatattgttcaggctgaaactcca
gggttgcgccaattaatggatgaatatgaaaaaacactttcttctattatcggtgttcag
caggtgcccgaagaagaaacacaccgctacggcattattgacccgctgacaagtgaaggc
cgccgttatcaggtgaaaaacttcgttgaaaaaccgcctaaaggcacagcaccttctaat
cttgccatcttaggccgttacgtattcacgcctgagatcttcatgtatttagaagagcag
caggttggcgccggcggagaaattcagctcacagacgccattcaaaagctgaatgaaatt
caaagagtgtttgcttacgattttgaaggcaagcgttatgatgttggtgaaaagctcggc
tttatcacaacaactcttgaatttgcgatgcaggataaagagcttcgcgatcagctcgtt
ccatttatggaaggtttactaaacaaagaagaaatctaa

DBGET integrated database retrieval system