KEGG   Bacillus subtilis subsp. subtilis 168: BSU35680Help
Entry
BSU35680          CDS       T00010                                 

Gene name
ggaB
Definition
(RefSeq) minor teichoic acid biosynthesis protein GgaB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyphos_transf Glycos_transf_2 Glyco_tranf_2_3 DUF1858 Glyco_trans_2_3
Motif
Other DBs
NCBI-GeneID: 936775
NCBI-ProteinID: NP_391448
Pasteur: BG11192
BSORF: BG11192
UniProt: P46918
Position
complement(3667209..3669911)
Genome map
AA seq 900 aa AA seqDB search
MNEKSFNYDFSVIMPIYNVELYLTEAIESIINQTIGFENIQLILVNDDSPDKSEIICKEY
AQKYPNNIVYAKKQNGGVSSARNYGLKYAEGRYIQFLDPDDLVSEGTFENVLNFFDEHKN
EIDIVAIPIFFAEGRTGEHNLNNKFSSTRILDVEKEPHHILTHCCSTFIKKDALKNIRFD
ENCKIGEDAKLVNLIISQKKKYGLVKEAKYHYRVREDGSSAMQTAKANKNWFNHSLITFS
KNLIDIIKNHEQKIPLFLQYMVMHDLKWKLLIKDISETPLDENEYSEFLTLIREVLSYID
DDVIIETKSVSHFYLYHALKIKHGENYSRYVYERETEQDYYLYREGKIVSKLSDQTLTIE
ILEENEDSIHIEGFWSSLFNSKGFKFYAKIGETKIKAKNIKRQHNDYISLGEVIKKYPGF
SIDIPKGHLADNHHIEFFITKGKKRKLTKLRFFKYSGLSNDLYNTYVAKKDYIFYYNYKK
LMFKKNNFKNRFIKEFRFLKSLHKSGEKSKKRKSAIKKALMARMVHHVFTIFNRKPVWLF
IDRQDKADDNAEHLFKYAINKNDGVKKYFIIKKDSKDYDRIKKYGKVIPYRSFRHKILTL
SSSKVISTHADIWVVNPFFNMEIYFRDLFNFEFIFLQHGITMADHSEWLNKYNKNIKLLV
TSAKPEYRSIVKGNYNYKKENILLGGFPRYDNLKKSEGEKQLLIMPTWRKDIVLPKDQAK
GVRPYNPKFKDSEYFSRYNALINDERLIEFAKKNNYKITFFPHPDIQQQIVDFEKHDYVE
FADYNSSYQMLFNSSNIMITDFSSVAFDFAYEKKPVIYYQYEKSYHFKLDYYDYKKMGFG
DVLENHNSLVDKVIYYMKNNSRMEDKYRKRVDNFFAYTDKNNRNRIYNAILELDNNKVAK
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaaagttttaactatgatttcagtgttataatgccgatttataatgttgag
ttgtatctcactgaagctatagaaagtatcattaaccaaactattggttttgagaatatt
cagttaatactggtgaatgatgatagccccgataaaagtgaaatcatttgtaaagaatat
gctcagaaatatcccaataacattgtctatgcaaagaaacagaatggcggagtgagcagt
gctcgaaattatggtttaaagtatgctgaaggtagatatattcaatttttggatccggat
gatttagtttcagaaggaacattcgaaaatgttttaaacttctttgacgaacataagaat
gaaattgatattgtagcaatccctattttttttgcagaaggaagaactggagaacataat
ctaaataataagttttcttctacaagaattttggatgtagaaaaagaaccgcatcatata
ttaactcattgttgttctacatttataaaaaaagatgccttgaaaaatatcaggtttgat
gaaaattgtaaaataggtgaagatgccaaactagttaatttaatcatatcgcaaaagaaa
aagtatggtctggttaaagaggcaaaataccattatagagttagagaagatggatcatct
gccatgcagactgctaaagcaaataagaattggtttaaccattcacttatcactttctca
aagaatttaatcgatattataaaaaatcatgaacagaaaatacctttatttcttcaatat
atggttatgcatgatttgaagtggaaattattgattaaggatatcagtgaaacaccttta
gacgaaaatgaatacagtgaatttttaacattgattcgagaagtattgtcgtatattgac
gacgatgtcatcattgaaacaaaaagtgtcagccatttctatttatatcatgctttaaaa
ataaagcacggtgaaaattatagtaggtatgtatatgaaagagaaactgaacaggattat
tatttatacagagaaggtaaaattgtttcgaaattatcggatcaaactttaactattgaa
attttagaagaaaatgaggattccattcacatagaaggcttttggagctcgctgtttaat
tctaaaggttttaagttttatgctaaaattggcgaaacaaaaataaaagcaaagaatata
aaaagacagcataatgattatataagtttaggagaagtaataaaaaaatatcccggtttt
tcaatagatattcccaaaggtcatctagcagataatcatcatattgagttttttataact
aagggtaaaaaaaggaagttgacaaaacttcgttttttcaagtattcaggtttgtcaaac
gatttatataatacttatgtggctaaaaaagattatattttttattataattataaaaaa
ttaatgttcaaaaaaaacaattttaaaaatagatttataaaagagtttcgtttcttaaaa
tccctacataaatcaggggaaaaatcaaaaaaacgaaaatcagcgattaagaaggcactg
atggcaagaatggtacaccatgttttcactatttttaatagaaaaccagtatggttattc
atagacagacaagacaaagctgatgataatgccgagcacctctttaaatatgcaatcaac
aagaatgatggggtaaaaaaatactttataataaaaaaagatagcaaggattacgacaga
atcaaaaaatatggaaaggtcataccatacagatcttttagacataaaattttaacctta
tcctcttccaaagtaatatcgacacatgcagatatatgggttgtaaatccattttttaat
atggagatttattttagagatttatttaactttgagtttatctttttacagcacggaata
acaatggcagatcattctgaatggttaaacaaatacaacaagaatatcaaattattagtc
acttctgccaaacctgaatatcggtctattgtgaaagggaattacaactataaaaaagag
aatattttgttgggtggatttccgagatacgataatcttaagaagagtgagggagaaaag
caacttctaataatgccgacttggagaaaagatattgtattaccgaaagatcaggcaaaa
ggagtaagaccgtacaacccgaaatttaaagatagtgaatatttttctaggtataatgct
ttgattaatgatgaacggctaatcgaatttgctaagaaaaataattataaaataactttt
tttcctcacccagatattcagcaacagattgtagactttgaaaagcatgattatgtggag
tttgccgactataacagcagctatcaaatgctatttaattcttctaatataatgattact
gatttttcatctgttgcgtttgattttgcatatgagaaaaaacctgttatttattatcaa
tacgaaaagtcataccattttaaacttgattattatgattataaaaaaatggggtttggt
gatgtattagaaaatcataatagcttagtggataaagttatctattatatgaaaaacaat
agtcgtatggaagataagtatagaaaaagagtagataacttttttgcatatactgataaa
aataataggaatcgtatttataatgctattttggaattagataataataaagttgctaaa
tga

DBGET integrated database retrieval system