KEGG   Bacillus subtilis subsp. subtilis 168: BSU35690Help
Entry
BSU35690          CDS       T00010                                 

Gene name
ggaA
Definition
(RefSeq) minor teichoic acid biosynthesis protein GgaA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 MMS19_C DUF5634_N
Motif
Other DBs
NCBI-GeneID: 936798
NCBI-ProteinID: NP_391449
Pasteur: BG11367
BSORF: BG11367
UniProt: P46917
Position
complement(3670035..3671375)
Genome map
AA seq 446 aa AA seqDB search
MFSIIIPIYNSENYLRYSIESVLNQSIGFKENIELILIDDGSVDSSPQICESFKNLYPNN
IKIMKIENSGPSAARNCGLSNVSERSKFIGFLDSDDAFSQNALQSVYDFFCDSEHVNIAV
LPVYYTGEKEGGHKLNNRFEKGTRVINILNDYKAIHFYIGGTFYRRHTLTSTVLFDESIK
FWEDAIFFNQLLLKEKRYGAVAEGKYFYRKRKEQDSLVDRSWFNKKRYTYLLNECYMTLL
MDSFNKYDIVLPYLQFLIVYHIKLFLYPNYRDVYKSVLDQQEQRVFVDDFIKVLKFIDPQ
FIKEQDMPMYYKEFMFHLLKENTEALENIKKERVLHSSCTVTSAKIKGLRLELTGHFINQ
YYEMKENDRIYIKYFKRLKKCKRKELKKTIEVWGYKLRDFRYAGFVVEIPIWAFAFDFVL
KTPNDSLELNHVNIFKSLLTRVFKKR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgttttctataattataccaatatataattctgaaaattatttaagatattcaatagag
agtgtccttaaccagtcaattggatttaaggaaaatatagaactgatattaatagatgat
ggtagtgttgacagcagtcctcaaatttgtgaatcctttaaaaatctatatcctaataat
attaaaatcatgaaaattgaaaactctggaccttctgctgcaagaaattgtggattatca
aatgtaagcgaaagatctaaatttattggttttcttgattctgacgatgcattctctcaa
aatgcgctgcaaagtgtttatgattttttttgtgattccgaacatgtaaatattgcggta
ttacctgtttattacacaggtgaaaaagaagggggacataaattaaataatagatttgaa
aaaggaacaagagttataaatattctcaacgattataaagctattcatttttatattggc
ggcactttttacagaagacatacactaactagtaccgtcctttttgatgaatctataaag
ttttgggaagacgctatcttttttaaccagttattactgaaagaaaaaagatacggagca
gttgcagaaggaaagtatttttatagaaaacggaaagaacaggattctttagttgatcgt
tcatggtttaacaaaaaaaggtacacatatttgttgaatgaatgttacatgactttgttg
atggattcattcaacaaatatgatatagttttgccttatttgcaatttttaattgtatat
catataaaactgtttttatatccgaactatagagatgtttataagtctgttttagatcaa
caagaacaaagagtttttgttgatgattttattaaagttttaaaatttattgacccgcaa
tttataaaagaacaagatatgccgatgtactataaagaatttatgtttcacttattaaaa
gaaaatacagaagctcttgaaaatataaaaaaagaaagagtactgcatagttcatgtact
gttacttcggcaaaaataaaagggcttagacttgaattaacagggcactttattaaccag
tattatgagatgaaagaaaatgacagaatatatataaaatattttaaaagattaaaaaaa
tgcaaacgaaaagaactgaaaaaaacaattgaagtatggggatataaattaagagatttt
agatatgctggttttgttgtcgaaataccgatttgggcctttgcatttgactttgtacta
aaaacaccaaatgattctttagaacttaaccatgtgaacatttttaaaagtttgcttaca
agggtttttaaaaaaaggtaa

DBGET integrated database retrieval system