KEGG   Bacillus subtilis subsp. subtilis 168: BSU35710Help
Entry
BSU35710          CDS       T00010                                 

Gene name
tagG
Definition
(RefSeq) teichoic acid translocation permease protein TagG
  KO
K09692  teichoic acid transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00251  Teichoic acid transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU35710 (tagG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU35710 (tagG)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Teichoic acid transporter [MD:M00251]
    BSU35710 (tagG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane
Motif
Other DBs
NCBI-GeneID: 936794
NCBI-ProteinID: NP_391452
Pasteur: BG11205
BSORF: BG11205
UniProt: P42953
Position
complement(3675167..3675994)
Genome map
AA seq 275 aa AA seqDB search
MNDLLRILREQITSFPLILRLAAYETKSKYQMNYLGVLWQFLNPLIQMLAYWFVFGMGIR
KGGPVTTGAGEVPFIIWMLAGLIPWFFISPTILDGSNSVFKRINMVAKMNFPISSLPSVA
IASNLFSYMIMMVIYIIVLLVNGVFPSVHWLQYIYYFICMIAFMFSFSLFNSTISVLIRD
YQFLLQAVTRLLFFLLPIFWDVNAKLGQSHPELVPVLKLNPLFYIIEGFRNSFLDGAWFF
HDMKYTLYFWLFTFLLLLVGSILHMKFRDKFVDFL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttgttgcgtatactcagagagcaaataacgtcatttcctttaattttaaga
ttggcggcttatgaaaccaagtctaaatatcaaatgaattatttaggtgtcttatggcag
ttcttaaatccgcttatccaaatgctggcctactggttcgtatttggtatggggattaga
aagggcggtcctgtgacaaccggagcgggcgaagtgccttttattatttggatgctggca
ggattaatcccatggtttttcatcagtccaactatacttgatggatcaaatagtgtattt
aagcgcattaatatggtggctaaaatgaacttcccgattagttctctaccgtccgtggca
attgcatctaacttatttagttatatgatcatgatggtgatttatatcattgtactccta
gttaatggtgtgttcccgagtgtgcattggttacaatatatttattacttcatctgtatg
attgcttttatgttttcgtttagtttgtttaactcaacgatcagtgtgctgattagagat
tatcaatttttgctgcaggccgtaacaagacttttgtttttcttgttgccaattttttgg
gatgttaatgcgaaactcggtcaaagccaccccgaattagtgcctgttctgaagttgaat
ccactattctatattattgaaggattccggaacagcttcttagatggagcatggtttttc
catgacatgaagtacacgctgtacttttggttgttcacattccttttattgttagtaggt
tctatcctgcatatgaaattcagagacaagtttgttgactttctttaa

DBGET integrated database retrieval system