KEGG   Bacillus subtilis subsp. subtilis 168: BSU35720Help
Entry
BSU35720          CDS       T00010                                 

Gene name
tagF
Definition
(RefSeq) CDP-glycerol:poly
  KO
K09809  CDP-glycerol glycerophosphotransferase [EC:2.7.8.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU35720 (tagF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.12  teichoic acid poly(glycerol phosphate) polymerase
     BSU35720 (tagF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyphos_transf
Motif
Other DBs
NCBI-GeneID: 936803
NCBI-ProteinID: NP_391453
Pasteur: BG10725
BSORF: BG10725
UniProt: P13485
Position
complement(3676159..3678399)
Genome map
AA seq 746 aa AA seqDB search
MSLVVDTNKRKQKGKSFYTEEQKKVMIENTVIKCILKSLKNNLGSLELLISIDSEHQFLE
DYQLFLKLKERRSGTESEFPLQNTGSLEYKTEINAHVLPMPVEMGQTYDFYVEFRKKYED
AEQEPLLKRLSAEVNSIERAFHVDQTTELLILPYTTDKGNFSIKVKREAKIIRFDQIEIS
SEEISITGYAGYLSSENQYRIKNLNLILKKGGETPIEEKFPIKLERKTHGLENMRADGFV
PELYDFEVKVPLKEIPFSNEKRYVYRLFMEYICNDDEGTDIQFNSTALVLGDRKNKLKGL
VSIIKTNNAPVRYEVFKKKKKQTLGIRVNDYSLKTRMKYFIKGKKKRLVSKIKKITKMRN
KLITKTYKSLFMMASRMPVKRKTVIFESFNGKQYSCNPRAIYEYMRENHPEYKMYWSVNK
QYSAPFDEKGIPYINRLSLKWLFAMARAEYWVVNSRLPLWIPKPSHTTYLQTWHGTPLKR
LAMDMEEVHMPGTNTKKYKRNFIKEASNWDYLISPNGYSTEIFTRAFQFNKTMIESGYPR
NDFLHNDNNEETISLIKSRLNIPRDKKVILYAPTWRDDQFYAKGRYKFDLDLDLHQLRQE
LGNEYIVILRMHYLVAENFDLGPFEGFAYDFSAYEDIRELYMVSDLLITDYSSVFFDFAN
LKRPMLFFVPDIETYRDKLRGFYFDFEKEAPGPLVKTTEETIEAIKQISSPDYKLPVSFG
PFYDKFCYLESGRSSEKVVNTVFKAE
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgtccttagtagttgacactaataaaaggaagcaaaaaggaaagagcttttatacagag
gagcagaaaaaagtaatgattgaaaacactgtgattaaatgtattttgaaaagcttgaaa
aacaatttaggaagtcttgaattgttaatctcaattgattcagaacaccaatttttagag
gattaccagttatttttaaagctgaaagagagacgttcaggaacggaatctgaatttccg
cttcaaaacactggctcattagagtataaaactgagataaatgctcatgttttgcctatg
cctgttgaaatgggacaaacatatgatttttatgtcgaatttcgaaaaaaatatgaagat
gcggagcaggaaccactcttgaagcgtctttctgctgaagtaaattcaattgagcgcgcc
tttcatgtcgatcaaaccacagaacttttgattttaccttatacaactgataaaggcaac
ttttctattaaggtgaaaagagaggccaaaatcatcagatttgatcaaatcgagattagc
tctgaagaaataagcataacaggttatgcggggtacctgagttccgaaaatcaatatcgg
ataaaaaacttgaaccttattttaaaaaagggtggagaaacacctattgaggaaaaattt
ccaatcaagctagaaagaaaaacacatggcctggaaaacatgagagcagatggttttgtt
ccggaactgtatgattttgaagtgaaagtgcctttgaaagaaattcctttctcaaatgaa
aaacgttatgtttatcgtctttttatggagtatatatgcaatgacgatgaaggaacggat
attcagttcaacagcactgctcttgttttaggagatcgaaaaaacaaattaaaaggatta
gtaagtattattaaaacaaacaacgcaccagttcgttatgaagtctttaagaaaaagaaa
aagcagactctaggtatcagagtaaacgactatagcctgaaaacaaggatgaaatacttt
attaaaggaaagaagaagagattagtatcaaaaataaaaaagatcacaaaaatgagaaac
aagttaatcactaaaacatacaaatctctattcatgatggctagcagaatgccagttaaa
aggaaaacagtcatttttgaaagttttaatgggaaacaatacagttgtaatccgagagcg
atttacgaatatatgcgggaaaaccaccctgagtataaaatgtattggagtgtaaataaa
caatattcagcgccttttgatgaaaagggaattccttacattaatcgcctctcattaaaa
tggctcttcgctatggcaagagctgagtattgggttgttaacagccggcttccattatgg
attccgaaacctagtcatacaacatatttacaaacatggcatggcacacctttaaaaaga
cttgcaatggatatggaagaagtccatatgcctggtacaaacaccaaaaaatataaaagg
aattttatcaaggaagcttctaattgggattacttgatttccccaaatggttattcaact
gagatctttacacgggcgtttcagtttaacaagacaatgattgaatctggatatcctaga
aatgattttcttcataatgataataatgaggaaacaatatcattgataaagagtaggtta
aatattcctcgtgataaaaaggttattttatatgcccctacatggagagatgatcagttc
tatgcaaaagggcgttataagttcgatctcgatttagatttgcatcaacttagacaagaa
cttggaaatgaatatattgtaatcttaagaatgcattatctggtagctgagaattttgat
ttaggtccttttgaaggatttgcatatgatttttctgcttatgaggatattcgagaattg
tatatggtttctgatttgctgattactgattattcttcagtattctttgattttgcaaat
ttaaaacggccaatgctattctttgtccctgacatcgaaacctaccgggacaagttgcgt
ggtttctactttgattttgaaaaagaagctcctggtcctttggtaaaaactactgaagaa
acgattgaggctatcaagcagatctcatcgcctgattataagcttccggtttcttttggt
cctttctatgataagttttgctatttagagtcaggacgttcatctgaaaaggttgttaat
actgtatttaaagctgaataa

DBGET integrated database retrieval system