KEGG   Bacillus subtilis subsp. subtilis 168: BSU35730Help
Entry
BSU35730          CDS       T00010                                 

Gene name
tagE
Definition
(RefSeq) poly(glycerol-phosphate) alpha-glucosyltransferase
  KO
K00712  poly(glycerol-phosphate) alpha-glucosyltransferase [EC:2.4.1.52]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU35730 (tagE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.52  poly(glycerol-phosphate) alpha-glucosyltransferase
     BSU35730 (tagE)
Glycosyltransferases [BR:bsu01003]
 Polysaccharide
  Bacterial polysaccharide
   BSU35730 (tagE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_A_1 Glycos_transf_1 Glyco_trans_1_4 DUF2963 Glyco_trans_1_2 DUF4020
Motif
Other DBs
NCBI-GeneID: 936804
NCBI-ProteinID: NP_391454
Pasteur: BG10724
BSORF: BG10724
UniProt: P13484
Position
complement(3678399..3680420)
Genome map
AA seq 673 aa AA seqDB search
MSLHAVSESNIKQIPDMDYYFISGGLPSNYGGLTKSLLLRSKLFGEECNQNTFFLTFRFD
LELSSKIDELYSNGKIDKKFTSVINLFDDFLSVRTNGKRSYEERIGLDQIKKQVGMGKFA
KTLLRLFGKKNNEMSVVYYGDGETIRYVDYWNDKNQLIKREEYTKNGNLVLVTHYDVQLN
KMYLQEYINDQNQVYLDKLYVWNNEEKDVQLSHIIWYSLEGEIKVKDESELRQYWIEYLQ
KQNDKPKLFLVDSRPQDKHVFKVKKSPSSYYGAIIHNKHYGSNKYQIKGRYKEVFSQMYN
LDAVFFITEEQLEDFKLISGEQETFFFTPHTIDKPLDPAVLNVPSEKYKAVIISRLASMK
NLIHAVKAFSLVVKEIPEAKLDIFGSGEDFEKIKKEIEDTKLQNNVFLKGYTDNPDSEFQ
KAWLTISTSHFEGFGLSNMEALSNGCPVVTYDYDYGARSLVTDGANGYVIEQYNIEKLGQ
AIISLMKDESTHQKFSEQAFKMAEKYSRPNYIENWAFALNQMIEVRIEREKFSKKVGKKD
PSISSYTEDFDKTKIEIDIENFDHNDIKKIRLVGLDRKNKAEIISTNLQNDQLFVIDLEK
DVNIEKIAANKTQVIDFYIVFNANGHIKTMRRLSSEETKLSGNSIDTNNGYRVEPYTTVK
GNFSWRVTEIKES
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
ttgtctttacatgcggtgagtgaatctaatataaaacaaattcctgacatggattattat
tttatctctggtggactgccaagtaattatggcggtctgacgaaatcattattattgcgt
tcaaaattatttggagaagagtgtaaccaaaacacctttttcttaacgtttcgttttgat
ttagagttgtcttcaaaaattgatgaattgtacagcaacggtaagattgataaaaaattc
acaagtgttattaatctattcgatgattttttaagtgttagaacaaatgggaaaagatca
tacgaagaaaggataggccttgaccagataaaaaagcaagttggaatggggaaatttgca
aaaactctgttgagattgtttggtaagaagaacaatgaaatgtctgtagtttactacgga
gatggagaaactatccggtacgtcgactattggaatgataaaaaccagctcataaagaga
gaggaatatacgaagaacggaaacttagttctcgttactcattatgatgtgcagctaaac
aagatgtatctgcaggaatatattaatgaccaaaatcaagtatatttagacaaactctat
gtatggaacaatgaagaaaaagatgttcaattatctcatattatttggtactcccttgag
ggtgagataaaagtaaaagatgaatcggaactgcgtcaatattggatagaatatctgcaa
aaacaaaatgataaacctaagttgtttttagtggacagcagaccgcaagacaaacatgtc
tttaaagtgaaaaaatcaccttcttcctattatggagcaattattcataacaagcattac
ggcagcaataaatatcaaattaagggtcgctataaagaagtatttagtcagatgtataat
ttggatgctgtcttttttataactgaggagcagctagaagattttaaattgatttcaggg
gaacaagagacgtttttctttactccgcatacaattgataagcctcttgatcccgctgta
ttgaatgtgccgagtgaaaaatacaaagctgtcattatttcaagacttgcatctatgaaa
aatctgatacatgcagtaaaagcatttagtttagtcgtgaaagaaattcctgaagcaaaa
cttgatatattcggatcgggtgaagatttcgaaaaaataaaaaaagaaattgaagatacc
aaactgcagaacaatgtctttttgaaaggctatacggataaccctgactcagagtttcaa
aaagcttggctaaccatttcaacctctcattttgaagggttcggtctatcaaatatggag
gcactgagcaatggatgtccagttgtaacatacgattatgattacggagcaaggagctta
gttactgacggagcaaatggatatgtcattgaacagtataatatagagaaattgggtcaa
gctattatctctttgatgaaagatgaaagtactcatcaaaaattttcagaacaagctttt
aaaatggctgaaaaatattcaagacccaactatattgaaaattgggcttttgctcttaat
cagatgattgaggtgcgaatagaaagagagaagttctctaaaaaggttggaaaaaaagat
ccttctattagttcctatactgaggattttgataaaactaaaatagaaattgacattgag
aattttgatcataatgatattaaaaaaatacgtttagtgggcttggacagaaagaataag
gctgaaattatttcaacaaacttacaaaatgatcaactgtttgtaattgatctcgaaaaa
gatgtaaatattgaaaagatagctgctaataaaacccaagttattgatttttatattgtt
ttcaatgcaaatggccatattaaaacaatgcgaagactttcgagtgaagaaacaaaattg
tcaggaaacagtatagatactaataatggctatagagtagagccctatacaacagttaaa
ggcaatttctcttggagggtcacggaaataaaagagagttaa

DBGET integrated database retrieval system