KEGG   Bacillus subtilis subsp. subtilis 168: BSU35740Help
Entry
BSU35740          CDS       T00010                                 

Gene name
tagD
Definition
(RefSeq) glycerol-3-phosphate cytidylyltransferase
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU35740 (tagD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     BSU35740 (tagD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like FAD_syn Pantoate_ligase DUF3242
Motif
Other DBs
NCBI-GeneID: 936809
NCBI-ProteinID: NP_391455
Pasteur: BG10449
BSORF: BG10449
UniProt: P27623
Structure
PDB: 

Position
complement(3680581..3680970)
Genome map
AA seq 129 aa AA seqDB search
MKKVITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILE
TIRYVDEVIPEKNWEQKKQDIIDHNIDVFVMGDDWEGKFDFLKDQCEVVYLPRTEGISTT
KIKEEIAGL
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttatcacatatggaacttttgatttactgcattggggtcacattaaattg
cttgagcgtgcaaagcagcttggtgattatttagttgttgctatttcaacggatgaattc
aatttacaaaagcaaaaaaaagcttatcacagctatgagcaccgtaaattaattttagaa
accattcgatatgtggacgaagtaattcctgaaaagaattgggagcaaaaaaagcaagat
attattgatcataatattgatgtttttgttatgggggatgactgggaaggtaaatttgac
tttctcaaagatcagtgtgaggttgtttacctcccaagaacagaaggcatctctacaaca
aagatcaaagaggaaattgctggtttataa

DBGET integrated database retrieval system