KEGG   Bacillus subtilis subsp. subtilis 168: BSU35750Help
Entry
BSU35750          CDS       T00010                                 

Gene name
tagA
Definition
(RefSeq) N-acetylmannosaminyltransferase
  KO
K05946  N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [EC:2.4.1.187]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU35750 (tagA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.187  N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase
     BSU35750 (tagA)
Glycosyltransferases [BR:bsu01003]
 Polysaccharide
  Bacterial polysaccharide
   BSU35750 (tagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 936810
NCBI-ProteinID: NP_391456
Pasteur: BG10450
BSORF: BG10450
UniProt: P27620
Position
3681370..3682140
Genome map
AA seq 256 aa AA seqDB search
MQTETIHNIPYVNSNLTSFIDYLEKHYIDQKIGAVISTVNPEIAFAAIKDRDYFDVLSSS
NFILPDGIGVVMMSRLTNNRLQSRIAGYDVFKELLGVANKKKKRIFLYGAKKDVIKGVVS
KISSEYPNIKIAGYSDGYVQDRTLVAKQIARANPDMVFVALGYPHQEKFIHNYRHLFPKA
VSIGLGGSFDVFSGNVKRAPSWMIRLNLEWFYRLILNPWRWKRMLSIPKYALTVLKEEKN
KKTFYPKPEKDHTKQI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagagactattcacaatattccttatgttaacagtaacttaacatcatttatc
gattacctagagaaacattatattgatcaaaagattggtgctgtcatttccacagtcaac
cctgaaattgcatttgcagctattaaagatcgggactactttgatgtactatcttcttca
aacttcattttgcctgatgggatcggtgtagtcatgatgtcacgtttgactaacaacagg
cttcagtcccgaatcgcaggttacgatgtttttaaagaacttctgggcgttgctaacaaa
aagaaaaaacgcatatttctgtacggtgcgaagaaagatgttataaaaggtgttgtatcc
aaaatttcttctgaatacccaaacattaaaatcgcaggttattcagacggttatgttcaa
gatcgcaccctagtggcaaaacaaattgcaagagcaaatcctgacatggtattcgtagct
ttagggtatcctcatcaagagaaattcattcataactacagacacttgttccctaaagcc
gtatctataggtctaggaggaagctttgatgtatttagcggtaatgtcaaacgggcccct
tcctggatgatacgtttaaatttagaatggttctaccggttaatcttgaatccatggcga
tggaaaagaatgcttagcatcccaaaatatgctttaacggttttaaaagaagaaaaaaac
aaaaaaactttctatccaaagcctgaaaaagatcatacaaaacagatttaa

DBGET integrated database retrieval system