KEGG   Bacillus subtilis subsp. subtilis 168: BSU35760
Entry
BSU35760          CDS       T00010                                 

Symbol
tagB
Name
(RefSeq) CDP-glycerol:glycerophosphate glycerophosphotransferase
  KO
K21285  teichoic acid glycerol-phosphate primase [EC:2.7.8.44]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU35760 (tagB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.44  teichoic acid glycerol-phosphate primase
     BSU35760 (tagB)
SSDB
Motif
Pfam: Glyphos_transf Epimerase_2 His_Phos_2
Other DBs
NCBI-GeneID: 936813
NCBI-ProteinID: NP_391457
Pasteur: BG10451
BSORF: BG10451
UniProt: P27621 A0A6M3ZL66
Position
3682173..3683318
AA seq 381 aa
MKIRSLLANCYLYFLSAIAFFLQWVKPESKVTLLISFEANAKAILEEYEQGQYSYKLNIL
YTQQASAIAESFPNVDAYLLQEKNPIHLIKAVYLMFNSKVIITDNYFLLTSVLNKRKQTK
CIQVWHANGSLKKFGLEDITNMQRTKTDIKRFQKVYSSYDYLTVGSEEMANIFKKSFGIK
DNQLLKIGVPLTDPYYRENKKKISDTLNIQRKKIILYAPTFRDYNMQSIQLPFTEEQLIH
QLKEEYVLFVKLHPAIQNNIDIKYSSDYIKDVSNYALFDLLMAADILITDYSSVPFEFSI
LNKPILFYTYDLKLYQQKRGLVDNYLSIIPGRACYDSESLINEIQTPFNYSKIKVFSDRW
NKYSDGNSSQNLLNFIENLIS
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgaaaataagatcactactggcgaattgctatttgtattttttatcagcaatcgccttt
tttctgcaatgggtgaaacctgaaagcaaagtgaccctcctgatctcattcgaagcaaac
gcaaaagcgattcttgaggaatatgaacaaggacaatactcttataaacttaacatcctg
tatacccagcaggcctctgctattgccgagagcttcccgaatgtagatgcatatttatta
caagaaaaaaaccctatccatctcattaaagctgtatacctaatgtttaacagtaaagtg
atcataacagataattactttctattaacaagtgtgttaaataagcggaagcaaacgaaa
tgtatccaagtatggcacgcaaatggctcactcaaaaaatttggtttggaagacattaca
aacatgcaacggacgaaaactgatattaaaaggttccaaaaagtatacagttcgtatgat
tatttaactgttggctcagaagagatggcaaatatcttcaagaaatcatttggaataaag
gataaccaattattaaaaataggtgtacctttaacagacccttattaccgagaaaacaag
aaaaaaatttcagatactctaaacatacaaagaaaaaaaataatcctctatgcaccgacg
tttagagattataatatgcaatcaattcaattgccttttacagaagaacaattaattcat
cagttaaaagaagaatatgttttatttgttaagctgcatcccgccattcagaacaatatt
gatattaaatattccagtgattatattaaagatgtttctaactatgccttgtttgatcta
ctcatggctgcagacatattaatcactgactattcttctgttccctttgaattttcgatt
ttaaataaacccattcttttttatacttacgatttaaaactttatcaacagaagcgggga
ttggttgataattatctttccataatacctggaagagcctgctatgacagtgaatcatta
ataaatgaaattcaaaccccatttaattattccaaaataaaagttttttccgatagatgg
aataagtattctgatgggaattcaagccaaaatttattgaatttcatcgaaaatttaata
agctaa

DBGET integrated database retrieval system