KEGG   Bacillus subtilis subsp. subtilis 168: BSU35780Help
Entry
BSU35780          CDS       T00010                                 

Gene name
lytD
Definition
(RefSeq) beta-N-acetylglucosaminidase
  KO
K01227  mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase [EC:3.2.1.96]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BSU35780 (lytD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.96  mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
     BSU35780 (lytD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPOR Glucosaminidase SH3_3
Motif
Other DBs
NCBI-GeneID: 936822
NCBI-ProteinID: NP_391459
Pasteur: BG10455
BSORF: BG10455
UniProt: P39848
Position
complement(3684826..3687468)
Genome map
AA seq 880 aa AA seqDB search
MKKRLIAPMLLSAASLAFFAMSGSAQAAAYTDYSLYKVEPSNTFSTESQASQAVAKLEKD
TGWDASYQASGTTTTYQISASGIHSESEAKAILSGLAKQTSITGTSSPVGSKQPYVTISS
GAISGEKQANTILAKLKQETGVAGAVKAYGAAQPYMNVMTSDIADETKVKALIQSLAKQT
GIKSSYQPITHTVSVTTIQSGTIVGDSRAAQIKNAFQKESGLQASLKETVKGQAYYTFTT
AAISGEANAKTLLQQLKQSTGITGSYKSINQKTTVESYNVQSAYFKGLSTVKDAISQIKK
NTGVSGSYQQVGKSTSYTVNMKGITKQQLQKIDTFFKKKKWHYTSSSVKKTTTSAAYQIT
TAKILGEQQANKAAAFFAQKKVKAAKTAAGSTAENQYQLISEETSDQAKVTKGLNILKKN
QLSASAKSVKKQIADTFKITTESLLDQTKVNQALTFFKSNHISVASQKTGQTAASSYQIT
TEAIISQEEIDRVLTFFKQNHIAVTTSKTGQTAYTQYKIVTTQLSSKTALNNGLTYLKSK
SVTPSYTTKSNTLYKISVNEQFTGNDTAAAASTKLKQLYGWTSSIVKIKNGPQIMKTNYN
LSLRDMVQKQMTVSPQTDGAAYVSLTYINTATSTVTADVLNIRSTPEVSPTNVIGQFKKG
DKVKVIGQINGWAKINLGWRNASSDEVVQYVDPNNFSRDSKYYFQFLKLSQTAGLSVTEV
NQKVLAGKGILTGRAKAFIDAANQYSINELYLISHALLETGNGTSALANGLTYNGKTVYN
MYGIGAYDSNPNYYGAKYAYEQGWFTPEAAIIGGAKFIGSSYIHNTAYNQDTLYKMRWSA
TATHQYATDIGWAYKQVNRMYSLYSLLDGYTLYFDVPEYR
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagactaatcgcacctatgcttctatccgccgcgtcccttgccttttttgcc
atgtctggttctgcccaggcagccgcgtataccgactactcactatataaagtagagccg
tcgaatacgttcagtacagaaagccaagcctcacaagctgtcgccaaactggaaaaagat
actggctgggatgcatcctatcaggcttcaggcacaacaacgacctaccaaatttccgcc
tcaggcattcatagcgaatcagaagcgaaagcaatactgagcggactcgccaaacagaca
tcaattacaggaacgtcaagtcctgttggaagcaaacagccatatgtcaccatctcgtca
ggtgccatctccggagaaaaacaggccaacactatcctagcaaagctgaaacaggagacg
ggagtggctggcgctgtaaaagcttacggagcagctcagccctatatgaacgtcatgaca
tcagacattgctgatgagacaaaagtcaaggcgcttatccagagcctggccaagcaaacg
gggattaaaagctcgtatcagcccatcacacacacggtgtctgtcacaaccattcagtct
ggcacaatcgtgggagacagcagagcagcgcagatcaaaaacgccttccaaaaggaatct
gggctgcaggcatcattaaaggaaacagtgaaagggcaagcctattatacgttcacaact
gccgccatttcaggtgaagccaatgccaaaactctattgcagcagctgaaacagagcact
ggcatcacaggcagctacaagtccatcaatcaaaaaacaaccgttgagtcatacaatgtc
caatcagcttatttcaaagggctgagtacagtaaaggacgccatcagccaaatcaagaaa
aacactggcgtatccggcagttatcaacaggttggaaaaagcacatcatataccgtgaat
atgaagggtataacaaaacagcagctccaaaaaatagacactttctttaaaaagaaaaaa
tggcattacacgtcatccagcgtcaaaaaaacgacaacgtctgcagcttatcaaatcacg
acggcaaagattttaggcgagcagcaagcaaacaaagcagcagccttctttgctcagaaa
aaagtaaaagctgcaaaaacagcagctggatcaacagcagaaaatcaatatcagctcatc
tcagaagaaacatcagatcaagcaaaagtcacaaagggtttgaacatattaaagaaaaat
cagctaagtgcttctgcgaaatccgtcaaaaaacaaatagctgacacgtttaaaatcaca
accgaatctctgcttgatcaaacgaaagtcaatcaggcactcacgtttttcaaatcgaat
catatatcagtagcaagccagaaaaccggtcagacagctgcgagcagctatcaaatcaca
actgaagctatcatcagccaagaagagattgaccgcgttttaacatttttcaaacaaaat
catatcgcagtcacaacatcaaaaacaggccagactgcatatacacaatacaaaatcgtg
acaacacagcttagcagcaaaaccgcattgaacaatgggttaacctatcttaaatcgaaa
agtgtaaccccgagctatacaacgaaaagcaatacgctttataaaatcagcgtaaatgag
cagttcacaggcaatgatacagctgctgcggcatcaacgaagctaaaacaattatacgga
tggacatcatctatcgtgaagatcaaaaacggcccgcaaatcatgaaaacaaactacaat
ctctcgcttcgtgatatggtccaaaaacaaatgacagtaagtccgcaaacagacggagcg
gcttacgtatcgctcacgtacattaatacagcaacatcaactgttacggctgatgtacta
aatatccggtcaacgccggaagtcagcccgacaaacgtgatcggccagtttaaaaaaggc
gataaagtgaaagtcatcggacagataaacggctgggctaagatcaatttgggctggcga
aacgcaagcagtgatgaagtagttcaatacgtggatccgaataacttttccagagacagc
aaatactacttccaatttctcaagctgtcacagacagcgggtctcagcgttactgaggta
aatcagaaagtgcttgcgggtaaaggcatcctgacagggagagcaaaggcatttatcgat
gccgccaatcaatatagcatcaacgaactgtatttaatctcacacgctcttctggaaaca
ggaaacgggacatccgctttagccaatggattaacctataacggaaaaaccgtatacaac
atgtatggaattggagcatacgacagcaatccgaattactacggagccaaatatgcgtac
gagcagggctggttcacaccagaagcggccattatcggcggagctaaattcataggctca
tcgtatatccacaacacagcttacaatcaagacacactgtacaaaatgagatggtcagct
acagcgacacatcaatacgcaacagacatcggctgggcgtacaaacaagtaaaccgcatg
tacagcctgtattcattgctggacggttatacactttattttgatgttccggaatatcga
taa

DBGET integrated database retrieval system