KEGG   Bacillus subtilis subsp. subtilis 168: BSU35790Help
Entry
BSU35790          CDS       T00010                                 

Gene name
yvyI
Definition
(RefSeq) mannose-6-phosphate isomerase YvyI
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU35790 (yvyI)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU35790 (yvyI)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BSU35790 (yvyI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMI_typeI Cupin_2 AraC_binding Cupin_3
Motif
Other DBs
NCBI-GeneID: 936815
NCBI-ProteinID: NP_391460
Pasteur: BG10454
BSORF: BG10454
UniProt: P39841
Structure
PDB: 

Position
complement(3687597..3688547)
Genome map
AA seq 316 aa AA seqDB search
MTQSPIFLTPVFKEKIWGGTALRDRFGYSIPSESTGECWAISAHPKGPSTVANGPYKGKT
LIELWEEHREVFGGVEGDRFPLLTKLLDVKEDTSIKVHPDDYYAGENEEGELGKTECWYI
IDCKENAEIIYGHTARSKTELVTMINSGDWEGLLRRIKIKPGDFYYVPSGTLHALCKGAL
VLETQQNSDATYRVYDYDRLDSNGSPRELHFAKAVNAATVPHVDGYIDESTESRKGITIK
TFVQGEYFSVYKWDINGEAEMAQDESFLICSVIEGSGLLKYEDKTCPLKKGDHFILPAQM
PDFTIKGTCTLIVSHI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatcaccgatttttctaacgcctgtgtttaaagaaaaaatctggggcggaacc
gctttacgagatagatttggatacagtattccttcagaatcaacgggggaatgctgggcc
atttccgctcatccaaaaggaccgagcactgttgcaaatggcccgtataaaggaaagaca
ttgatcgagctttgggaagagcaccgtgaagtattcggcggcgtagagggggatcggttt
ccgcttctgacaaagctgctggatgtgaaggaagatacgtcaattaaagttcaccctgat
gattactatgccggagaaaacgaagagggagaactcggcaagacggaatgctggtacatt
atcgactgtaaggaaaacgcagaaatcatttacgggcatacggcccgctcaaaaaccgaa
cttgtcacaatgatcaacagcggtgactgggagggcctgctgcgaagaatcaaaattaaa
ccgggtgatttctattatgtgccgagcggaacgctgcacgcattgtgcaagggggccctt
gttttagagactcagcaaaattcagatgccacataccgggtgtacgattatgaccgtctt
gatagcaacggaagtccgagagagcttcattttgccaaagcggtcaatgccgccacggtt
ccccatgtggacgggtatatagatgaatcgacagaatcaagaaaaggaataaccattaaa
acatttgtccaaggggaatatttttcggtttataaatgggacatcaatggcgaagctgaa
atggctcaggatgaatcctttctgatttgcagcgtgatagaaggaagcggtttgctcaag
tatgaggacaaaacatgtccgctcaaaaaaggtgatcactttattttgccggctcaaatg
cccgattttacgataaaaggaacttgtacccttatcgtgtctcatatttaa

DBGET integrated database retrieval system