KEGG   Bacillus subtilis subsp. subtilis 168: BSU35800
Entry
BSU35800          CDS       T00010                                 

Symbol
gerBA
Name
(RefSeq) spore germination protein B1
  KO
K06291  spore germination protein BA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU35800 (gerBA)
SSDB
Motif
Pfam: GerA
Other DBs
NCBI-GeneID: 936814
NCBI-ProteinID: NP_391461
Pasteur: BG10640
BSORF: BG10640
UniProt: P39569 A0A6M3ZH62
Position
3688812..3690263
AA seq 483 aa
MQIDSDLQNNLDTLKKTLGQNDDMMFYTFAFGDSRQKACLLYIDGLTENKMLAQYVISPL
QKEALAHKECSIEDLSAFFFGFHHSVVSTMKEIEQLVFSGQAILLADGYRGGLAFDTKSV
ATRSLDEPSSEVVERGPKIGFIEKLRTNTALLRERTSDPNLVIKEMTLGKRTKKKIAVAY
IQDIAPDYVVKEVFKRLKSVNIDNLPESGTLEQLIEDEPFSIFPTILSTERPDRVESSLL
EGRVSILVDGTPFALIVPATVDEFIHSPDDYSQRWIPMSLVRLLRYSSILITIYLPGLYI
SLVSFHTGLLPTRMAISIAGSRLNVPFPPFVEAFIMIFTIELIREAGLRLPKPIGQTIGL
IGGVVIGQAAVQAQIVSALMVIVVSVTALASFTVPSYAYNFPLRIIRIGVMISATALGMY
GVIMVYLFVIGHLMRLKSFGQDYIIPIMAQPGQDLKDTVIRIPTMFLKRRPTRNDPEDNI
RQR
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgcaaatcgactctgatctccagaacaatttagacacactgaaaaaaacattgggacaa
aacgacgatatgatgttttatacatttgctttcggagatagcagacaaaaggcgtgttta
ctgtatattgacggtctgacagagaataaaatgctggcgcaatacgtcatttctccttta
caaaaagaggcgttggcccataaggaatgctcgattgaagacttatccgccttttttttc
ggctttcaccacagcgttgtttctacaatgaaagaaatagagcagctcgttttttcaggg
caagccattttgctcgctgatggctatcgcggaggattagctttcgacacaaagtcagtc
gcaacacgcagtcttgatgaaccctcctccgaagtcgtggaacgcggccctaaaatagga
tttattgaaaagctgcggacaaacacggcgcttttgcgtgaacggacgagtgatcctaat
ctcgtcatcaaagaaatgacactcggaaaaaggaccaaaaagaaaatcgctgtcgcttat
attcaggatatcgccccagattatgtcgtcaaagaagtgtttaaaaggctgaaatcagtc
aatatagataatttgccggaatcggggacgcttgaacagctgattgaagacgaaccattt
tcaattttccccacaatattaagcacagaacgaccggaccgggtcgaaagttctctatta
gaagggcgagtgtccatattagtggatggtacgccgtttgctttgattgtaccggctacg
gttgacgaatttattcattcgcccgatgattacagccagcgctggatcccaatgtcactt
gtacgccttcttcgttattccagcatcctgatcaccatttatttgcccggtctgtatatt
tctctcgtttcttttcacaccgggctattgccgactagaatggccatttccattgcaggc
agcaggcttaacgtaccattcccgccttttgtagaggcctttatcatgatctttacgatc
gaattgattcgagaagccggattaaggctgcctaagccgattggacagacaattggcctt
atcggcggcgttgtcatcggacaggcagctgttcaggcgcaaattgtcagtgcgcttatg
gtcattgtcgtttctgtcacagcactggcatcctttaccgttccttcatacgcctataac
tttccgctgcggatcattcggatcggggttatgataagtgcaacagcgcttggcatgtac
ggcgttataatggtttatctgtttgtgatcggccatctcatgcgcctgaaaagctttggc
caggattacattatcccgatcatggcgcagcctggacaggatttgaaagacacagtcatc
cgtattcccacgatgtttttaaaaagaagaccgacacgaaacgatcccgaagataacatc
agacaaaggtga

DBGET integrated database retrieval system