KEGG   Bacillus subtilis subsp. subtilis 168: BSU35810Help
Entry
BSU35810          CDS       T00010                                 

Gene name
gerBB
Definition
(RefSeq) spore germination protein B2
  KO
K06292  spore germination protein BB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU35810 (gerBB)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU35810 (gerBB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_permease Trp_Tyr_perm Aa_trans
Motif
Other DBs
NCBI-GeneID: 936827
NCBI-ProteinID: NP_391462
Pasteur: BG10641
BSORF: BG10641
UniProt: P39570
Position
3690269..3691375
Genome map
AA seq 368 aa AA seqDB search
MRKSEHKLTFMQTLIMISSTLIGAGVLTLPRSAAETGSPSGWLMILLQGVIFIIIVLLFL
PFLQKNSGKTLFKLNSIVAGKFIGFLLNLYICLYFIGIVCFQARILGEVVGFFLLKNTPM
AVVVFIFLAVAIYHVGGGVYSIAKVYAYIFPITLIIFMMLLMFSFRLFQLDFIRPVFEGG
YQSFFSLFPKTLLYFSGFEIIFYLVPFMRDPKQVKKAVALGIATSTLFYSITLLIVIGCM
TVAEAKTVTWPTISLIHALEVPGIFIERFDLFLQLTWTAQQFACMLGSFKGAHIGLTEIF
HLKNKNNAWLLTAMLAATFFITMYPKDLNDVFYYGTLLGYAFLIVITIPFFVWFLSWIQK
KIGRGQLQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaatcagagcataaactgacatttatgcagacgctcattatgatcagcagcaca
ttgattggtgccggggtgctgacccttccccgctcagccgccgaaaccggcagtccgagc
ggatggctaatgatactgctccagggcgttatttttattatcatcgttctgctttttttg
ccttttcttcaaaaaaacagcggaaaaactctttttaagctcaacagcattgtagctgga
aaattcatcggctttctattgaatttatatatctgtctatatttcattgggattgtttgc
tttcaagctcggattttgggagaggttgtcggattctttttgttgaaaaatacgccaatg
gcagttgtggtgtttatatttcttgcagttgccatctatcatgtaggcggaggcgtttat
tcaattgcaaaagtatacgcttatatttttcctataacccttattatttttatgatgctt
ctgatgttcagctttcgcttgttccagcttgattttatccggccggtatttgaaggaggc
tatcaaagctttttctctttattcccaaaaacattattatatttctccggatttgaaatc
attttttacctggtcccctttatgagagatccaaagcaagtgaaaaaggctgttgctctg
ggcatcgcgacttccacattgttctacagcattactttgctcattgtgattggctgtatg
actgtggctgaggcaaaaacggtgacatggccgaccatttcccttattcacgcattagag
gttccgggtatttttattgaacgatttgatttgttcttacagctgacctggacagcccag
caatttgcctgtatgctcggatcctttaaaggcgcccatatcgggttaacggaaatcttt
catctaaaaaataaaaacaatgcatggctgctgactgcaatgctggctgcgacgtttttc
ataacgatgtatcccaaggacttgaatgacgtgttttattacgggacgcttcttggatat
gctttcttaattgtgattacaattccattcttcgtctggtttttaagctggatacagaaa
aaaatagggagggggcagctgcaatga

DBGET integrated database retrieval system