KEGG   Bacillus subtilis subsp. subtilis 168: BSU35820Help
Entry
BSU35820          CDS       T00010                                 

Gene name
gerBC
Definition
(RefSeq) spore germination protein B3
  KO
K06293  spore germination protein BC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU35820 (gerBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_GerAC LIN37
Motif
Other DBs
NCBI-GeneID: 936819
NCBI-ProteinID: NP_391463
Pasteur: BG10642
BSORF: BG10642
UniProt: P39571
Structure
PDB: 

Position
3691372..3692496
Genome map
AA seq 374 aa AA seqDB search
MKTASKFSVMFFMLLALCGCWDVKDIEQLSFARGLAIDETNDHQYKLTYQNLLPQSEDSQ
ASGKPEFVNVTSHGKTILEAVSDVSIKDPPVYSDHLKVILLGEKLMRNQNVDQVLNHFIR
DDELRRSSYLMAARGNAADVFTKGNPNQQQPMPSEKLIDLTTHSGYNGKIMIPLRIGRAS
VYSQNGYSYLIQAVKNEKGKAKYDGAGIIKRGSNKLVGFLSADETQTLSWVMGTIQGGVM
PTTDKGHPITFEIKKSKTKIKPVIENGKPVFHISVKTKGILTEDQNPNENSFSKSYLHRL
ENIFEKKLERDVKQVMDKLQHEYKTDPVFLSDHIRIQHPDYWNKVKGHWDEIFSETDFKY
DISFKIINFGTVGK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagcatcaaaattctccgtcatgttttttatgctgctggccctctgcggctgc
tgggatgtcaaagatatcgagcaactatccttcgccagagggctggcgatcgatgagaca
aatgatcaccagtacaaactgacgtatcaaaatcttcttccccaaagcgaagacagccaa
gcatccggaaaacccgaatttgttaatgtaacgtcccacgggaaaacgattctggaagca
gtcagtgatgtatccatcaaggaccctcctgtttatagcgatcatttaaaagtgatcctt
ctgggagaaaaactgatgaggaatcaaaatgtagaccaagtcctcaaccactttatccgg
gatgatgagctgcggcgaagcagctatttgatggcagccagagggaatgcagctgatgtt
ttcacaaaaggaaaccccaatcagcagcagccgatgccctccgaaaaactgattgatttg
acaactcacagcggatataacggtaagattatgataccgctgcgcatcggaagagcttct
gtctactctcagaacgggtacagttatcttattcaagccgtgaaaaacgaaaagggaaaa
gccaagtatgacggagcaggcattatcaaaaggggcagcaataaactcgttgggtttctt
tcagctgatgaaacccaaacactgtcatgggtcatggggacgatccaaggcggtgtcatg
ccgacgacagataaaggacatccgattacgtttgaaattaaaaagtcgaaaacgaaaatt
aagcccgtcattgaaaacggaaagcctgtctttcatatttctgttaaaacgaagggcatc
ctgacagaagaccaaaacccgaatgaaaactcctttagcaaaagttatttgcacaggctg
gaaaacatttttgaaaaaaagcttgaacgagatgtaaagcaggtgatggataaactgcag
cacgagtataaaaccgatccggtctttttatcagaccacataaggattcaacaccctgac
tactggaataaagtaaaagggcattgggatgaaatattttctgagactgattttaagtac
gatatttcttttaaaatcattaactttggcacggtgggaaagtaa

DBGET integrated database retrieval system