KEGG   Bacillus subtilis subsp. subtilis 168: BSU35830Help
Entry
BSU35830          CDS       T00010                                 

Gene name
ywtG
Definition
(RefSeq) metabolite transport protein YwtG
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU35830 (ywtG)
Transporters [BR:bsu02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    BSU35830 (ywtG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12 MFS_1_like
Motif
Other DBs
NCBI-GeneID: 936832
NCBI-ProteinID: NP_391464
Pasteur: BG12538
BSORF: BG12538
UniProt: C0SPB2
Position
complement(3692533..3693906)
Genome map
AA seq 457 aa AA seqDB search
MKKQSNIWLYFFGALGGALYGYDTGVISGAILFMKKELGLNAFTEGLVVSSLLVGAILGS
GAAGKLTDRFGRKKAIMAAALLFCIGGLGVALAPNTGVMVLFRIILGLAVGTSTTIVPLY
LSELAPKHKRGALSSLNQLMITVGILLSYIVNYIFADAEAWRWMLGLAAVPSLLLLIGIL
FMPESPRWLFTNGEESKAKKILEKLRGTKDIDQEIHDIKEAEKQDEGGLKELFDPWVRPA
LIAGLGLAFLQQFIGTNTIIYYAPKTFTNVGFGNSASILGTVGIGTVNVLMTLVAIKIID
KIGRKPLLLFGNAGMVISLIVLALVNLFFDNTPAASWTTVICLGVFIVVFAVSWGPVVWV
MLPELFPLHVRGIGTGVSTLMLHVGTLIVSLTYPILMEAIGISYLFLIYAAIGIMAFLFV
RFKVTETKGRSLEEIEQDLRDKNGQGGAAGKQQTVGT
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcagtcaaatatatggctttattttttcggagctcttggaggcgcgttatat
ggctatgataccggagtgatttccggagctattttatttatgaaaaaggagttaggctta
aacgcgtttacagaaggtcttgttgtcagctccttgctggttggggcgatattgggctca
ggagcggccggcaagctgactgaccgtttcggaagaaaaaaagcaattatggcagccgcg
ctgctgttttgtataggcggtcttggtgtggcactggccccaaatacaggagtcatggtg
ctgtttcgcatcattttgggacttgcagtcggaacatcgacgacaatcgtacccctttat
ttatctgaactggcgccaaaacataaacgcggggcgctgtcatcactgaatcagctgatg
atcacggtcggcatccttctttcttacattgtcaattacatatttgccgatgccgaagcg
tggcgctggatgcttggattggctgctgtgccgtcattgctcttgcttattggcattttg
tttatgccggagagcccgcgctggctgttcacgaatggcgaagaaagcaaagcgaagaaa
attcttgaaaaattgcgtggcacaaaagatattgatcaggaaatacatgatataaaagaa
gcggaaaagcaggatgaaggcggtctgaaggagctgttcgatccatgggtgcgcccagcg
cttattgcaggtttgggactcgcttttttgcagcaatttatcggaacgaatacgatcatc
tactatgcgccaaagacctttacaaacgtcggattcggaaactccgcttcgattttaggc
acggtcggaatcggcacagtcaatgttctcatgacattagtagcgattaaaatcatcgac
aagattggaagaaagccgttactgctattcgggaatgcgggcatggtgatcagcttgatc
gttctcgctttagtaaatctctttttcgataacactccggctgcctcatggacgaccgtc
atttgtttaggcgtgtttatcgttgtctttgcggtcagctggggaccggttgtgtgggtg
atgcttcctgaattgttcccgcttcacgtcagaggaatcgggaccggtgtttcgacctta
atgttgcacgttgggacactgattgtttcattaacctatccaatattaatggaagcgatc
ggaatcagttatttattcctgatttatgccgcgatcggtatcatggcgttcttatttgtc
cgatttaaagtgacagagacaaagggaagaagccttgaagaaattgagcaggatttacgg
gacaaaaacggacagggaggagcggccggaaaacagcagactgtcggaacataa

DBGET integrated database retrieval system