KEGG   Bacillus subtilis subsp. subtilis 168: BSU35840Help
Entry
BSU35840          CDS       T00010                                 

Gene name
ywtF
Definition
(RefSeq) transcriptional regulator YwtF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytR_cpsA_psr AlgF DUF4179
Motif
Other DBs
NCBI-GeneID: 936823
NCBI-ProteinID: NP_391465
Pasteur: BG12537
BSORF: BG12537
UniProt: Q7WY78
Structure
PDB: 

Position
3694239..3695207
Genome map
AA seq 322 aa AA seqDB search
MEERSQRRKKKRKLKKWVKVVAGLMAFLVIAAGSVGAYAFVKLNNASKEAHVSLARGEQS
VKRIKEFDPGKDSFSVLLLGIDAREKNGETVDQARSDANVLVTFNRKEKTAKMLSIPRDA
YVNIPGHGYDKFTHAHAYGGVDLTVKTVEEMLDIPVDYVVESNFTAFEDVVNELNGVKVT
VKSDKVIQQIKKDTKGKVVLQKGTHTLDGEEALAYVRTRKADSDLLRGQRQMEVLSAIID
KSKSLSSIPAYDDIVDTMGQNLKMNLSLKDAIGLFPFITSLKSVESIQLTGYDYEPAGVY
YFKLNQQKLQEVKKELQNDLGV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacgatcacagcgcagaaagaaaaaaagaaaactaaaaaaatgggtgaaagtt
gttgccggattaatggcttttttagtcattgcggcaggctctgtcggcgcctatgctttt
gtaaagctgaacaatgcttctaaggaagctcatgtcagccttgcacgcggagaacaatct
gtaaaacggatcaaagaatttgatcctggaaaagattctttttctgtattgctcttagga
attgatgccagggagaaaaacggcgagaccgtcgatcaggcaagaagtgacgcgaatgtg
ctggttacatttaatcggaaagaaaaaacagctaaaatgctgagcattccgcgtgacgcc
tatgtaaacatcccaggccacgggtatgataaattcacacatgctcacgcttacggcggc
gttgacttaactgtgaaaacagttgaagaaatgctggatattccagtcgattatgtcgta
gaaagcaatttcacggcttttgaagacgtcgtaaacgagttaaatggcgtcaaagtaact
gtaaaaagcgataaagtcattcagcaaatcaaaaaagatacaaaaggtaaagtcgttctt
caaaaaggaacacatacgcttgatggggaagaagcgctcgcttacgtaagaacacgtaaa
gcggacagtgaccttttacgcgggcaaagacaaatggaagtgctgagcgccattatagat
aaatcaaaatcattgagctcaattccggcttatgatgatattgtggatacgatggggcaa
aatttaaaaatgaacttatctcttaaagatgccatcggcctgttcccgttcatcacttca
ttgaaatcagttgagtctattcagctgacgggttatgattatgaacctgccggagtctat
tatttcaaattgaatcagcaaaagctgcaggaagttaaaaaagagctgcaaaacgattta
ggtgtataa

DBGET integrated database retrieval system