KEGG   Bacillus subtilis subsp. subtilis 168: BSU35840
Entry
BSU35840          CDS       T00010                                 

Symbol
ywtF
Name
(RefSeq) transcriptional regulator YwtF
  KO
K01005  polyisoprenyl-teichoic acid--peptidoglycan teichoic acid transferase [EC:2.7.8.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU35840 (ywtF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     BSU35840 (ywtF)
SSDB
Motif
Pfam: LytR_cpsA_psr
Other DBs
NCBI-GeneID: 936823
NCBI-ProteinID: NP_391465
Pasteur: BG12537
BSORF: BG12537
UniProt: Q7WY78 A0A6M3ZJT3
Structure
Position
3694239..3695207
AA seq 322 aa
MEERSQRRKKKRKLKKWVKVVAGLMAFLVIAAGSVGAYAFVKLNNASKEAHVSLARGEQS
VKRIKEFDPGKDSFSVLLLGIDAREKNGETVDQARSDANVLVTFNRKEKTAKMLSIPRDA
YVNIPGHGYDKFTHAHAYGGVDLTVKTVEEMLDIPVDYVVESNFTAFEDVVNELNGVKVT
VKSDKVIQQIKKDTKGKVVLQKGTHTLDGEEALAYVRTRKADSDLLRGQRQMEVLSAIID
KSKSLSSIPAYDDIVDTMGQNLKMNLSLKDAIGLFPFITSLKSVESIQLTGYDYEPAGVY
YFKLNQQKLQEVKKELQNDLGV
NT seq 969 nt   +upstreamnt  +downstreamnt
atggaagaacgatcacagcgcagaaagaaaaaaagaaaactaaaaaaatgggtgaaagtt
gttgccggattaatggcttttttagtcattgcggcaggctctgtcggcgcctatgctttt
gtaaagctgaacaatgcttctaaggaagctcatgtcagccttgcacgcggagaacaatct
gtaaaacggatcaaagaatttgatcctggaaaagattctttttctgtattgctcttagga
attgatgccagggagaaaaacggcgagaccgtcgatcaggcaagaagtgacgcgaatgtg
ctggttacatttaatcggaaagaaaaaacagctaaaatgctgagcattccgcgtgacgcc
tatgtaaacatcccaggccacgggtatgataaattcacacatgctcacgcttacggcggc
gttgacttaactgtgaaaacagttgaagaaatgctggatattccagtcgattatgtcgta
gaaagcaatttcacggcttttgaagacgtcgtaaacgagttaaatggcgtcaaagtaact
gtaaaaagcgataaagtcattcagcaaatcaaaaaagatacaaaaggtaaagtcgttctt
caaaaaggaacacatacgcttgatggggaagaagcgctcgcttacgtaagaacacgtaaa
gcggacagtgaccttttacgcgggcaaagacaaatggaagtgctgagcgccattatagat
aaatcaaaatcattgagctcaattccggcttatgatgatattgtggatacgatggggcaa
aatttaaaaatgaacttatctcttaaagatgccatcggcctgttcccgttcatcacttca
ttgaaatcagttgagtctattcagctgacgggttatgattatgaacctgccggagtctat
tatttcaaattgaatcagcaaaagctgcaggaagttaaaaaagagctgcaaaacgattta
ggtgtataa

DBGET integrated database retrieval system