KEGG   Bacillus subtilis subsp. subtilis 168: BSU35850Help
Entry
BSU35850          CDS       T00010                                 

Gene name
ywtE
Definition
(RefSeq) hypothetical protein
  KO
K21064  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase [EC:3.1.3.104]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU35850 (ywtE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.104  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
     BSU35850 (ywtE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase Trehalose_PPase HAD HAD_2 Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 936824
NCBI-ProteinID: NP_391466
Pasteur: BG12536
BSORF: BG12536
UniProt: P96741
Position
3695363..3696223
Genome map
AA seq 286 aa AA seqDB search
MKCIAIDLDGTLLNKESVISAENREAIKRAVDAGILVTICTGRATFDVKALLDDLDIPII
AANGGTIHDTGYRLISRTLMDQEAGKAIADYLLSKNIYFEVYTDDHLLSPFDGEAKLHAE
LDILKSANPNEQTDDLWQGAMTQFKQFGIKPIPHIESVFDGGENIYKLLCFSFDMDKLKQ
AKEELKHHKKLAQTSSGKHIIEILPASSGKGRALTKLADIYGIETQDIYAIGDSPNDLSM
FEVAGHRIAMENAIDELKEKSTFVTKSNDENGVAYFIDQLLSGQYA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtattgcgattgatctagacggaacattactgaataaagaaagcgtcatttct
gcggaaaacagagaggcgatcaagcgggccgttgatgccggcatcctcgtcaccatttgc
acgggaagagcgacatttgatgtaaaagcgctgctggatgacttggacatccctatcatt
gcagctaatggcggtacgatccacgacacgggttaccgtttgatcagccggacattaatg
gatcaggaagccggtaaagcgattgctgattacttactttcaaaaaacatttactttgag
gtatatacagatgaccatctgctttctccttttgacggcgaagctaagctgcacgcggag
cttgacattctaaagagcgcaaacccaaacgagcagacggatgacttgtggcaaggagcc
atgactcaattcaaacagtttggcattaaaccaatccctcatatcgaatcggtttttgac
ggcggtgaaaacatttataagcttctttgcttctcctttgatatggacaagctgaaacaa
gcgaaggaagaactgaagcatcataaaaaactggcgcaaacctcttcaggaaaacatatt
atcgaaatcctgccggcctcgtcaggaaaaggacgcgcgttaacaaagctggctgacata
tacggaattgaaacacaggatatctatgcgatcggcgatagtccaaacgatttgtccatg
tttgaagtcgccggacaccgtatcgccatggaaaatgcgattgatgaattaaaagaaaaa
agcacctttgtcacaaaaagcaatgacgaaaatggtgtggcctactttatagaccagctt
ctttcggggcaatatgcataa

DBGET integrated database retrieval system