KEGG   Bacillus subtilis subsp. subtilis 168: BSU35860
Entry
BSU35860          CDS       T00010                                 

Symbol
pgdS
Name
(RefSeq) gamma-dl-glutamyl hydrolase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NLPC_P60 Peptidase_C92 LRAT CHAP End_beta_barrel Amidase_5
Other DBs
NCBI-GeneID: 936837
NCBI-ProteinID: NP_391467
Pasteur: BG12535
BSORF: BG12535
UniProt: P96740 A0A6M3ZL68
Position
complement(3696257..3697498)
AA seq 413 aa
MNTLANWKKFLLVAVIICFLVPIMTKAEIAEADTSSELIVSEAKNLLGYQYKYGGETPKE
GFDPSGLIQYVFSKADIHLPRSVNDQYKIGTAVKPENLKPGDILFFKKEGSTGTVPTHDA
LYIGDGQMVHSTQSKGVIITNYKKSSYWSGTYIGARRIAADPATADVPVVQEAEKYIGVP
YVFGGSTPSEGFDCSGLVQYVFQQALGIYLPRSAEQQWAVGEKVAPQNIKPGDVVYFSNT
YKTGISHAGIYAGAGRFIQASRSEKVTISYLSEDYWKSKMTGIRRFDNLTIPKENPIVSE
ATLYVGEVPYKQGGVTPETGFDTAGFVQYVYQKAAGISLPRYATSQYNAGTKIEKADLKP
GDIVFFQSTSLNPSIYIGNGQVVHVTLSNGVTITNMNTSTYWKDKYAGSIRVQ
NT seq 1242 nt   +upstreamnt  +downstreamnt
gtgaacacactggcaaactggaagaagtttttgcttgtggcggttatcatttgttttttg
gttccaattatgacaaaagcggagattgcggaagctgatacatcatcagaattgattgtc
agcgaagcaaaaaacctgcttggatatcagtataaatatggcggggaaacgccgaaagag
ggtttcgatccatcaggattgatacaatatgtgttcagtaaggctgatattcatctgccg
agatctgtaaacgaccagtataaaatcggaacagctgtaaaaccggaaaacctgaagccg
ggtgatattttgtttttcaagaaagagggaagcaccggcactgttccgacacatgacgcc
ctttatatcggagacggccaaatggttcacagtacacagtcaaaaggggttatcatcacc
aattacaaaaaaagcagctattggagcggaacttatatcggggcgagacgaatcgctgcc
gatccggcaacggctgatgttcctgtcgttcaggaggccgaaaaatatatcggtgtccca
tatgtgtttggcggaagcacgccgtcagagggctttgattgctcggggcttgtgcaatat
gtgtttcaacaggcactcggcatttatctaccgcgatcagccgaacagcagtgggcagtg
ggcgagaaggtagcccctcagaacataaagcctggtgatgtcgtctatttcagcaatacg
tataaaacgggaatttcacatgcaggcatttatgcgggcgcaggcaggttcattcaggca
agccggtcagaaaaagtaaccatttcctatttgtcagaggattactggaaatcgaagatg
acgggtattcgccgatttgacaacctgacaatcccgaaagaaaatccgattgtttccgaa
gcgacgctttatgtcggagaagtgccttacaaacagggcggagtaacacctgagacggga
tttgatacagctggatttgtccaatatgtataccagaaagcagccggtatttccctgcct
cgatacgcaacaagccagtacaatgccggaactaagattgagaaggcggacctgaagccg
ggagacattgtgttctttcaatcaacaagcttaaatccctccatctatatcggaaacgga
caagttgttcatgtcacattatcaaacggcgtgaccattaccaatatgaacacgagcaca
tattggaaggataaatacgcaggaagtatacgggtgcaataa

DBGET integrated database retrieval system