KEGG   Bacillus subtilis subsp. subtilis 168: BSU35870
Entry
BSU35870          CDS       T00010                                 

Symbol
pgsE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-GeneID: 936828
NCBI-ProteinID: NP_391468
Pasteur: BG12534
BSORF: BG12534
UniProt: P96739 A0A6M3ZHP1
Position
complement(3697639..3697806)
AA seq 55 aa
MKFVKAIWPFVAVAIVFMFMSAFKFNDQLTDQEKQKIDMEMNKIQQQEEPVNANK
NT seq 168 nt   +upstreamnt  +downstreamnt
atgaaatttgtcaaagccatctggccgtttgttgccgtagccatcgtgttcatgtttatg
tcagcttttaaattcaatgatcagctgacagatcaggaaaaacagaagattgatatggaa
atgaataaaatccagcagcaggaagaaccggtaaacgccaataaataa

DBGET integrated database retrieval system