KEGG   Bacillus subtilis subsp. subtilis 168: BSU35880Help
Entry
BSU35880          CDS       T00010                                 

Gene name
pgsA
Definition
(RefSeq) PGA biosynthesis protein CapA
  KO
K07282  gamma-polyglutamate biosynthesis protein CapA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    BSU35880 (pgsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGA_cap ABC2_membrane_3 DUF4448
Motif
Other DBs
NCBI-GeneID: 936830
NCBI-ProteinID: NP_391469
Pasteur: BG12533
BSORF: BG12533
UniProt: P96738
Position
complement(3697821..3698963)
Genome map
AA seq 380 aa AA seqDB search
MKKELSFHEKLLKLTKQQKKKTNKHVFIAIPIVFVLMFAFMWAGKAETPKVKTYSDDVLS
ASFVGDIMMGRYVEKVTEQKGADSIFQYVEPIFRASDYVAGNFENPVTYQKNYKQADKEI
HLQTNKESVKVLKDMNFTVLNSANNHAMDYGVQGMKDTLGEFAKQNLDIVGAGYSLSDAK
KKISYQKVNGVTIATLGFTDVSGKGFAAKKNTPGVLPADPEIFIPMISEAKKHADIVVVQ
SHWGQEYDNDPNDRQRQLARAMSDAGADIIVGHHPHVLEPIEVYNGTVIFYSLGNFVFDQ
GWTRTRDSALVQYHLKKNGTGRFEVTPIDIHEATPAPVKKDSLKQKTIIRELTKDSNFAW
KVEDGKLTFDIDHSDKLKSK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaactgagctttcatgaaaagctgctaaagctgacaaaacagcaaaaaaag
aaaaccaataagcacgtatttattgccattccgatcgtttttgtccttatgttcgctttc
atgtgggcgggaaaagcggaaacgccgaaggtcaaaacgtattctgacgacgtactctca
gcctcatttgtaggcgatattatgatgggacgctatgttgaaaaagtaacggagcaaaaa
ggggcagacagtatttttcaatatgttgaaccgatctttagagcctcggattatgtagca
ggaaactttgaaaacccggtaacctatcaaaagaattataaacaagcagataaagagatt
catctgcagacgaataaggaatcagtgaaagtcttgaaggatatgaatttcacggttctc
aacagcgccaacaaccacgcaatggattacggcgttcagggcatgaaagatacgcttgga
gaatttgcgaagcaaaatcttgatatcgttggagcgggatacagcttaagtgatgcgaaa
aagaaaatttcgtaccagaaagtcaacggggtaacgattgcgacgcttggctttaccgat
gtgtccgggaaaggtttcgcggctaaaaagaatacgccgggcgtgctgcccgcagatcct
gaaatcttcatccctatgatttcagaagcgaaaaaacatgcggacattgttgttgtgcag
tcacactggggacaagagtatgacaatgatccaaatgaccgccagcgccagcttgcaaga
gccatgtctgatgcgggagctgacatcatcgtcggccatcacccgcacgtcttagaaccg
attgaagtatataacggaaccgtcattttctacagcctcggcaactttgtctttgaccaa
ggctggacgagaacaagagacagtgcactggttcagtatcacctgaagaaaaatggaaca
ggacgctttgaagtgacaccgatcgatatccatgaagcgacacctgcgcctgtgaaaaaa
gacagccttaaacagaaaaccattattcgcgaactgacgaaagactctaatttcgcttgg
aaagtagaagacggaaaactgacgtttgatattgatcatagtgacaaactaaaatctaaa
taa

DBGET integrated database retrieval system