KEGG   Bacillus subtilis subsp. subtilis 168: BSU35890Help
Entry
BSU35890          CDS       T00010                                 

Gene name
pgsC
Definition
(RefSeq) PGA biosynthesis protein CapC
  KO
K22116  gamma-polyglutamate biosynthesis protein CapC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    BSU35890 (pgsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Caps_synth_CapC
Motif
Other DBs
NCBI-GeneID: 936840
NCBI-ProteinID: NP_391470
Pasteur: BG12532
BSORF: BG12532
UniProt: P96737
Position
complement(3698982..3699431)
Genome map
AA seq 149 aa AA seqDB search
MFGSDLYIALILGVLLSLIFAEKTGIVPAGLVVPGYLGLVFNQPVFILLVLLVSLLTYVI
VKYGLSKFMILYGRRKFAAMLITGIVLKIAFDFLYPIVPFEIAEFRGIGIIVPGLIANTI
QKQGLTITFGSTLLLSGATFAIMFVYYLI
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgttcggatcagatttatacatcgcactaattttaggtgtactactcagtttaattttt
gcggaaaaaacagggatcgtgccggcaggacttgttgtaccgggatatttaggacttgtg
tttaatcagccggtctttattttacttgttttgctagtgagcttgctcacgtatgtcatt
gtgaaatacggtttatccaaatttatgattttgtacggacgcagaaaattcgctgccatg
ctgataacagggatcgtcctaaaaatcgcgtttgattttctatacccgattgtaccattt
gaaatcgcagaatttcgaggaatcggcatcatcgtgccaggtttaattgccaataccatt
cagaaacaaggtttaaccattacgttcggaagcacgctgctattgagcggagcgaccttt
gctatcatgtttgtttactacttaatttaa

DBGET integrated database retrieval system