KEGG   Bacillus subtilis subsp. subtilis 168: BSU35900Help
Entry
BSU35900          CDS       T00010                                 

Gene name
pgsB
Definition
(RefSeq) PGA synthase CapB
  KO
K01932  gamma-polyglutamate synthase [EC:6.3.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU35900 (pgsB)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     BSU35900 (pgsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M
Motif
Other DBs
NCBI-GeneID: 936833
NCBI-ProteinID: NP_391471
Pasteur: BG12531
BSORF: BG12531
UniProt: P96736
Position
complement(3699446..3700627)
Genome map
AA seq 393 aa AA seqDB search
MWLLIIACAVILVIGILEKRRHQKNIDALPVRVNINGIRGKSTVTRLTTGILIEAGYKTV
GKTTGTDARMIYWDTPEEKPIKRKPQGPNIGEQKEVMRETVERGANAIVSECMAVNPDYQ
IIFQEELLQANIGVIVNVLEDHMDVMGPTLDEIAEAFTATIPYNGHLVITDSEYTEFFKQ
KAKERNTKVIIADNSKITDEYLRKFEYMVFPDNASLALGVAQALGIDEETAFKGMLNAPP
DPGAMRILPLISPSEPGHFVNGFAANDASSTLNIWKRVKEIGYPTDDPIIIMNCRADRVD
RTQQFANDVLPYIEASELILIGETTEPIVKAYEEGKIPADKLHDLEYKSTDEIMELLKKR
MHNRVIYGVGNIHGAAEPLIEKIHEYKVKQLVS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtggttactcattatagcctgtgctgtcatactggtcatcggaatattagaaaaacga
cgacatcagaaaaacattgatgccctccctgttcgggtgaatattaacggcatccgcgga
aaatcgactgtgacaaggctgacaaccggaatattaatagaagccggttacaagactgtt
ggaaaaacaacaggaacagatgcaagaatgatttactgggacacaccggaggaaaagccg
attaaacggaaacctcaggggccgaatatcggagagcaaaaagaagtcatgagagaaaca
gtagaaagaggggctaacgcgattgtcagtgaatgcatggctgttaacccagattatcaa
atcatctttcaggaagaacttctgcaggccaatatcggcgtcattgtgaatgttttggaa
gaccatatggatgtcatggggccgacgcttgatgaaattgcagaagcgtttactgctaca
attccttataatggccatcttgtcattacagatagtgaatataccgagttctttaaacaa
aaagcaaaagaacgaaacacaaaagtcatcattgctgataactcaaaaattacagatgag
tatttacgtaaatttgaatacatggtattccctgataacgcttctctggcgctgggtgtg
gctcaagcactcggcattgacgaagaaacagcatttaagggaatgctgaatgcgccgcca
gatccgggagcaatgagaattcttccgctgatcagtccgagcgagcctgggcactttgtt
aatgggtttgccgcaaacgacgcttcttctactttgaatatatggaaacgtgtaaaagaa
atcggttacccgaccgatgatccgatcatcatcatgaactgccgcgcagaccgtgtcgat
cggacacagcaattcgcaaatgacgtattgccttatattgaagcaagtgaactgatctta
atcggtgaaacaacagaaccgatcgtaaaagcctacgaagaaggcaaaattcctgcagac
aaactgcatgatctagagtataagtcaacagatgaaattatggaattgttaaagaaaaga
atgcacaaccgtgtcatatatggcgtcggcaatattcatggtgccgcagagcctttaatt
gaaaaaatccacgaatacaaggtaaagcagctcgtaagctag

DBGET integrated database retrieval system