KEGG   Bacillus subtilis subsp. subtilis 168: BSU35910
Entry
BSU35910          CDS       T00010                                 

Symbol
rbsR
Name
(RefSeq) ribose operon repressor
  KO
K02529  LacI family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU35910 (rbsR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    BSU35910 (rbsR)
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 RraA-like
Other DBs
NCBI-GeneID: 936836
NCBI-ProteinID: NP_391472
Pasteur: BG10876
BSORF: BG10876
UniProt: P36944 A0A6M4JPT2
Position
3701411..3702391
AA seq 326 aa
MATIKDVAGAAGVSVATVSRNLNDNGYVHEETRTRVIAAMAKLNYYPNEVARSLYKRESR
LIGLLLPDITNPFFPQLARGAEDELNREGYRLIFGNSDEELKKELEYLQTFKQNHVAGII
AATNYPDLEEYSGMNYPVVFLDRTLEGAPSVSSDGYTGVKLAAQAIIHGKSQRITLLRGP
AHLPTAQDRFNGALEILKQAEVDFQVIETASFSIKDAQSMAKELFASYPATDGVIASNDI
QAAAVLHEALRRGKNVPEDIQIIGYDDIPQSGLLFPPLSTIKQPAYDMGKEAAKLLLGII
KKQPLAETAIQMPVTYIGRKTTRKED
NT seq 981 nt   +upstreamnt  +downstreamnt
ttggctacaattaaagatgtcgccggagcggcgggcgtttcagttgcgacggtttcccgc
aacctgaatgataacggctatgtacacgaagaaacgcgaacgcgtgtcatagcggcgatg
gcgaagctgaactattacccgaatgaagtcgccagatctctatataaaagagaatcccga
ctgatcggacttttgctcccggatatcacaaaccctttcttcccccagcttgcccgcggt
gcggaggatgaattgaaccgggaaggctatcgccttattttcggcaacagtgacgaggaa
ttgaaaaaagaacttgaataccttcaaacctttaagcaaaatcatgtcgcaggcattatt
gccgcaacgaattacccggatctcgaggaatacagcggcatgaattatccagttgttttt
ctggacagaacgcttgaaggggctccttctgtgtccagtgacggctatacaggagtaaag
ttagccgcccaggctatcattcacggaaaaagccagcgcattacgctcttgagaggaccc
gctcacctgccgaccgctcaagaccgatttaacggcgctttggaaatcttaaagcaggct
gaagttgattttcaggtcattgagacagcttcattttcaattaaagatgcacaatcgatg
gcgaaggagctgtttgcctcttatccagcgacagatggtgtgatcgcgagtaatgatatt
caagccgctgccgttttacatgaagcattgcggcgcggaaaaaacgtgccggaggacatt
caaattatcggctatgatgacattccgcaaagcggacttctgttcccgccactttctaca
attaaacagcccgcatatgatatggggaaagaagctgccaaactgcttttgggtatcatt
aaaaaacagccgctggcagaaacggcaattcaaatgcctgtcacctatataggaagaaag
acgacaagaaaggaagattaa

DBGET integrated database retrieval system