KEGG   Bacillus subtilis subsp. subtilis 168: BSU35920Help
Entry
BSU35920          CDS       T00010                                 

Gene name
rbsK
Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU35920 (rbsK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BSU35920 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 936844
NCBI-ProteinID: NP_391473
Pasteur: BG10877
BSORF: BG10877
UniProt: P36945
Position
3702393..3703274
Genome map
AA seq 293 aa AA seqDB search
MRNICVIGSCSMDLVVTSDKRPKAGETVLGTSFQTVPGGKGANQAVAAARLGAQVFMVGK
VGDDHYGTAILNNLKANGVRTDYMEPVTHTESGTAHIVLAEGDNSIVVVKGANDDITPAY
ALNALEQIEKVDMVLIQQEIPEETVDEVCKYCHSHDIPIILNPAPARPLKQETIDHATYL
TPNEHEASILFPELTISEALALYPAKLFITEGKQGVRYSAGSKEVLIPSFPVEPVDTTGA
GDTFNAAFAVALAEGKDIEAALRFANRAASLSVCSFGAQGGMPTRNEVEELLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatatttgtgtgattggtagctgttctatggatttagtggtcacctcggacaaa
cgcccaaaagccggtgaaacggttcttggcacgtcatttcagactgtgccgggcggcaaa
ggagcaaatcaggccgttgccgcagccagacttggggcgcaagtgtttatggtcggcaaa
gttggagacgatcattatggaacagctattttgaataatctcaaagctaacggcgttcgc
actgattatatggaaccggttacacatacggaaagcggaaccgctcatattgtgcttgct
gaaggcgacaacagcattgtcgttgtcaaaggcgcgaacgatgacatcaccccagcgtat
gcgttaaacgcgctcgaacagattgaaaaggtcgatatggtgctgattcagcaggaaatc
ccagaagaaacggttgatgaggtgtgcaaatactgccattctcacgatatcccgatcata
ctaaacccagcaccggcccgcccgctcaagcaggaaacaattgatcacgctacctatctg
acgccgaatgaacacgaggcttcgattttattccctgagcttaccatttccgaagctctg
gcgctttatccggcaaagctctttattacggaaggaaaacaaggcgtccgctattcggct
ggcagcaaagaggtgctcatcccgtccttccctgtagaacccgttgatacaaccggagcc
ggtgatacgtttaacgcagcatttgccgtggccctggctgagggaaaagacattgaagcc
gcattgcggtttgccaatcgtgccgcttccctttctgtctgctccttcggtgcccaaggc
ggaatgccgacaagaaatgaagtagaggagctgctgtcatga

DBGET integrated database retrieval system