KEGG   Bacillus subtilis subsp. subtilis 168: BSU35930Help
Entry
BSU35930          CDS       T00010                                 

Gene name
rbsD
Definition
(RefSeq) D-ribose pyranase
  KO
K06726  D-ribose pyranase [EC:5.4.99.62]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU35930 (rbsD)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.62  D-ribose pyranase
     BSU35930 (rbsD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RbsD_FucU
Motif
Other DBs
NCBI-GeneID: 936846
NCBI-ProteinID: NP_391474
Pasteur: BG10878
BSORF: BG10878
UniProt: P36946
Structure
PDB: 

Position
3703271..3703666
Genome map
AA seq 131 aa AA seqDB search
MKKHGILNSHLAKILADLGHTDKIVIADAGLPVPDGVLKIDLSLKPGLPAFQDTAAVLAE
EMAVEKVIAAAEIKASNQENAKFLENLFSEQEIEYLSHEEFKLLTKDAKAVIRTGEFTPY
ANCILQAGVLF
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacacggtatactgaacagccatcttgccaagattttagccgaccttggccac
actgataaaattgtcatcgcggatgccggactgccggttcctgacggcgttttgaaaatt
gatctttcactgaagccgggccttccggctttccaagatacagcggcagtactggctgag
gaaatggcggtcgaaaaagtcattgctgcagctgaaataaaagcatccaatcaggagaat
gcgaaatttctagaaaatcttttctctgaacaagagattgaatacctttctcacgaggag
tttaagctgctgacaaaagatgcaaaggcagtcataagaacaggagaattcacaccatat
gccaactgcatcctgcaggcaggtgtacttttctag

DBGET integrated database retrieval system