KEGG   Bacillus subtilis subsp. subtilis 168: BSU35940
Entry
BSU35940          CDS       T00010                                 

Symbol
rbsA
Name
(RefSeq) ribose import ATP-binding protein RbsA
  KO
K10441  ribose transport system ATP-binding protein [EC:7.5.2.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU35940 (rbsA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU35940 (rbsA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.7  ABC-type D-ribose transporter
     BSU35940 (rbsA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    BSU35940 (rbsA)
SSDB
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase SMC_N AAA_29 AAA_30 MMR_HSR1 ABC_ATPase AAA_22 AAA RNA_helicase AAA_23 Acid_phosphat_B AAA_13 DLIC
Other DBs
NCBI-GeneID: 936839
NCBI-ProteinID: NP_391475
Pasteur: BG10879
BSORF: BG10879
UniProt: P36947
Position
3703682..3705163
AA seq 493 aa
MQIEMKDIHKTFGKNQVLSGVSFQLMPGEVHALMGENGAGKSTLMNILTGLHKADKGQIS
INGNETYFSNPKEAEQHGIAFIHQELNIWPEMTVLENLFIGKEISSKLGVLQTRKMKALA
KEQFDKLSVSLSLDQEAGECSVGQQQMIEIAKALMTNAEVIIMDEPTAALTEREISKLFE
VITALKKNGVSIVYISHRMEEIFAICDRITIMRDGKTVDTTNISETDFDEVVKKMVGREL
TERYPKRTPSLGDKVFEVKNASVKGSFEDVSFYVRSGEIVGVSGLMGAGRTEMMRALFGV
DRLDTGEIWIAGKKTAIKNPQEAVKKGLGFITENRKDEGLLLDTSIRENIALPNLSSFSP
KGLIDHKREAEFVDLLIKRLTIKTASPETHARHLSGGNQQKVVIAKWIGIGPKVLILDEP
TRGVDVGAKREIYTLMNELTERGVAIIMVSSELPEILGMSDRIIVVHEGRISGEIHAREA
TQERIMTLATGGR
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgcagattgaaatgaaagacattcataaaacattcggaaaaaatcaggtgctgtcaggc
gtttcctttcagctcatgcctggcgaggttcacgcattaatgggagaaaacggcgccggc
aagtccacgcttatgaacattttgacaggcctgcacaaagcagataaaggtcaaatcagc
ataaacggaaacgaaacgtatttttccaatccgaaagaagcggaacagcatggaatagcc
tttatccatcaggaattgaatatctggccggaaatgaccgttcttgagaatctatttatc
ggtaaagagatatcctccaagctgggcgttttacaaacaagaaaaatgaaagcgctagca
aaagagcaatttgacaaactttccgtctctctttctcttgatcaagaagccggcgaatgt
tccgtcggacagcagcaaatgatcgaaattgcaaaagcgcttatgacaaatgccgaggta
atcattatggatgaaccgaccgcagcgttgactgaacgtgaaatcagcaagctctttgag
gtcattacagcgttaaaaaagaacggcgtctccattgtctatatttcgcatcgcatggaa
gaaatttttgcgatttgcgacagaattaccatcatgcgtgacggaaaaacggtagataca
acaaacatctcagaaactgattttgatgaagtcgtcaaaaaaatggtcggacgggagctg
actgaacgatatccaaaacgcactccttctctcggtgacaaagtattcgaggtgaaaaat
gcttccgtaaaagggagttttgaggacgtcagcttttatgtgcgttccggtgagatcgtc
ggtgtttcaggattaatgggagccggccggacagaaatgatgagagcgctgttcggcgtt
gacaggctggacacgggtgagatatggatcgctgggaaaaaaacggctattaagaacccg
caggaagccgtgaaaaaaggtctcggctttattacagagaatcgcaaggatgaagggctc
ctgctcgacacctcgatccgcgaaaatattgccctgcccaatctgtccagcttctcacca
aagggtctcattgatcataagcgggaggctgaatttgtcgatctgttaatcaagcgcctc
actatcaaaacagcatcaccggaaacgcacgcacgccatttatcaggaggaaaccagcaa
aaagtggtgatagccaagtggatcggcatcggaccgaaagtgcttatcttggatgagcca
accagaggtgtggatgttggcgccaaacgagagatttatacgctgatgaatgagctgacc
gaacgcggtgtcgctatcatcatggtgtcatcagagcttcctgaaattctgggaatgagc
gatcggattatcgttgtccatgaaggcagaatcagcggcgaaatccatgcgcgagaagca
acacaagaacgaattatgacacttgccacgggagggcggtaa

DBGET integrated database retrieval system