KEGG   Bacillus subtilis subsp. subtilis 168: BSU35940Help
Entry
BSU35940          CDS       T00010                                 

Gene name
rbsA
Definition
(RefSeq) ribose import ATP-binding protein RbsA
  KO
K10441  ribose transport system ATP-binding protein [EC:3.6.3.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU35940 (rbsA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU35940 (rbsA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     BSU35940 (rbsA)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212]
    BSU35940 (rbsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase SMC_N AAA_30 AAA_29 ABC_ATPase MMR_HSR1 AAA_22 AAA_23 AAA RNA_helicase Acid_phosphat_B AAA_15 AAA_13 DLIC Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 936839
NCBI-ProteinID: NP_391475
Pasteur: BG10879
BSORF: BG10879
UniProt: P36947
Position
3703682..3705163
Genome map
AA seq 493 aa AA seqDB search
MQIEMKDIHKTFGKNQVLSGVSFQLMPGEVHALMGENGAGKSTLMNILTGLHKADKGQIS
INGNETYFSNPKEAEQHGIAFIHQELNIWPEMTVLENLFIGKEISSKLGVLQTRKMKALA
KEQFDKLSVSLSLDQEAGECSVGQQQMIEIAKALMTNAEVIIMDEPTAALTEREISKLFE
VITALKKNGVSIVYISHRMEEIFAICDRITIMRDGKTVDTTNISETDFDEVVKKMVGREL
TERYPKRTPSLGDKVFEVKNASVKGSFEDVSFYVRSGEIVGVSGLMGAGRTEMMRALFGV
DRLDTGEIWIAGKKTAIKNPQEAVKKGLGFITENRKDEGLLLDTSIRENIALPNLSSFSP
KGLIDHKREAEFVDLLIKRLTIKTASPETHARHLSGGNQQKVVIAKWIGIGPKVLILDEP
TRGVDVGAKREIYTLMNELTERGVAIIMVSSELPEILGMSDRIIVVHEGRISGEIHAREA
TQERIMTLATGGR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgaaatgaaagacattcataaaacattcggaaaaaatcaggtgctgtcaggc
gtttcctttcagctcatgcctggcgaggttcacgcattaatgggagaaaacggcgccggc
aagtccacgcttatgaacattttgacaggcctgcacaaagcagataaaggtcaaatcagc
ataaacggaaacgaaacgtatttttccaatccgaaagaagcggaacagcatggaatagcc
tttatccatcaggaattgaatatctggccggaaatgaccgttcttgagaatctatttatc
ggtaaagagatatcctccaagctgggcgttttacaaacaagaaaaatgaaagcgctagca
aaagagcaatttgacaaactttccgtctctctttctcttgatcaagaagccggcgaatgt
tccgtcggacagcagcaaatgatcgaaattgcaaaagcgcttatgacaaatgccgaggta
atcattatggatgaaccgaccgcagcgttgactgaacgtgaaatcagcaagctctttgag
gtcattacagcgttaaaaaagaacggcgtctccattgtctatatttcgcatcgcatggaa
gaaatttttgcgatttgcgacagaattaccatcatgcgtgacggaaaaacggtagataca
acaaacatctcagaaactgattttgatgaagtcgtcaaaaaaatggtcggacgggagctg
actgaacgatatccaaaacgcactccttctctcggtgacaaagtattcgaggtgaaaaat
gcttccgtaaaagggagttttgaggacgtcagcttttatgtgcgttccggtgagatcgtc
ggtgtttcaggattaatgggagccggccggacagaaatgatgagagcgctgttcggcgtt
gacaggctggacacgggtgagatatggatcgctgggaaaaaaacggctattaagaacccg
caggaagccgtgaaaaaaggtctcggctttattacagagaatcgcaaggatgaagggctc
ctgctcgacacctcgatccgcgaaaatattgccctgcccaatctgtccagcttctcacca
aagggtctcattgatcataagcgggaggctgaatttgtcgatctgttaatcaagcgcctc
actatcaaaacagcatcaccggaaacgcacgcacgccatttatcaggaggaaaccagcaa
aaagtggtgatagccaagtggatcggcatcggaccgaaagtgcttatcttggatgagcca
accagaggtgtggatgttggcgccaaacgagagatttatacgctgatgaatgagctgacc
gaacgcggtgtcgctatcatcatggtgtcatcagagcttcctgaaattctgggaatgagc
gatcggattatcgttgtccatgaaggcagaatcagcggcgaaatccatgcgcgagaagca
acacaagaacgaattatgacacttgccacgggagggcggtaa

DBGET integrated database retrieval system