KEGG   Bacillus subtilis subsp. subtilis 168: BSU35950Help
Entry
BSU35950          CDS       T00010                                 

Gene name
rbsC
Definition
(RefSeq) ribose transport system permease RbsC
  KO
K10440  ribose transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU35950 (rbsC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU35950 (rbsC)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212]
    BSU35950 (rbsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-GeneID: 936841
NCBI-ProteinID: NP_391476
Pasteur: BG10880
BSORF: BG10880
UniProt: P36948
Position
3705165..3706133
Genome map
AA seq 322 aa AA seqDB search
MKTEQLQTEQKRIHFDGVMQKLGPFLGLFILVIIVSILNPSFLEPLNILNLLRQVAINGL
IAFGMTFVILTGGIDLSVGAILALSSALVAGMIVSGVDPVLAIILGCIIGAVLGMINGLL
ITKGKMAPFIATLATMTVFRGLTLVYTDGNPITGLGTNYGFQMFGRGYFLGIPVPAITMV
LAFVILWVLLHKTPFGRRTYAIGGNEKAALISGIKVTRVKVMIYSLAGLLSALAGAILTS
RLHSAQPTAGESYELDAIAAVVLGGTSLSGGRGRIVGTLIGVLIIGTLNNGLNLLGVSSF
YQLVVKGIVILIAVLLDRKKSA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggaacaactgcaaacagaacaaaaacggattcacttcgacggagtcatgcaa
aaactcggcccgtttcttggtttatttattctcgttatcattgtatctattttaaatccc
agctttcttgaaccgctgaatattttaaacctgcttcgccaggtcgccattaacggatta
atcgcgttcgggatgacctttgttattttgacaggcggcattgatctttctgttggcgct
attcttgccctgtccagtgctttagttgcggggatgattgtgtccggtgtcgatccggtt
ctcgcgatcatccttggctgtatcattggtgccgtactaggcatgatcaacggattattg
attactaaaggaaaaatggcgccctttatcgccacgcttgcgaccatgactgtgtttcgc
ggactgacgctagtgtatacagatggaaatccgattaccggacttggcacaaactacggt
tttcagatgttcggacgcggttactttttaggcattcctgtaccggcaattacgatggtt
cttgcctttgtcatcctttgggtgcttcttcataaaacaccattcggacgccgaacgtac
gctatcggcggcaacgaaaaagccgcgctcatttcaggcatcaaagtgacgcgcgtgaaa
gtgatgatctattctttagccgggcttttatccgctcttgcaggtgccatattgacttcc
cgcctgcattcggcccagccgactgcgggagaatcgtacgaacttgatgctatcgcggca
gtcgtcttaggagggacaagtctttccggcggccgaggacgcattgtcggcacgttaatc
ggggtgctgatcatcggcacacttaataacggacttaatctgcttggcgtctcatcattt
tatcagctggttgtcaaagggattgttatcttaattgcggtattgttagaccgcaagaag
tcagcttag

DBGET integrated database retrieval system