KEGG   Bacillus subtilis subsp. subtilis 168: BSU35970Help
Entry
BSU35970          CDS       T00010                                 

Gene name
ywsB
Definition
(RefSeq) cell wall-binding protein YwsB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SH3_3 SH3_1 SH3_4 SH3_9 hSH3
Motif
Other DBs
NCBI-GeneID: 936850
NCBI-ProteinID: NP_391478
Pasteur: BG12530
BSORF: BG12530
UniProt: P96729
Position
3707144..3707680
Genome map
AA seq 178 aa AA seqDB search
MNKPTKLFSTLALAAGMTAAAAGGAGTIHAQQPETTVSIDDLYSYPIDSYLVSAEALNVR
TKPSASSQKADTLHLGDSLKLISFSNADWAKVKYKNGKTGFVSTHYIVKAATTVKTKTKT
KVYTSADGKSIKTLPADTSVSFLGWSKTNKGGFDFDWVFVDYGGTTGYMKTKDLHMTK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaccaacaaaactattttcaacattagcacttgcggctggaatgactgcggcg
gctgctggcggcgctggcacgatccatgctcaacagccagaaacaacggtaagcattgat
gatttatacagttatccgattgattcttatttggtatcagcagaggctctaaatgtcaga
acgaagccttccgcatcaagccagaaagccgatacgctgcacttaggagatagcctaaag
ctgatttccttctcaaatgctgactgggcaaaggttaagtataaaaatggaaaaacagga
tttgtatccactcattacattgttaaagcagcgacaacggtaaaaaccaaaacaaaaaca
aaagtgtatacatccgctgacggaaagagcattaagactcttccagcagacacaagcgtt
tcttttttaggctggagtaaaacgaataaaggcggttttgattttgattgggtattcgtt
gattacggcggtacgacaggttatatgaaaacaaaggatttacacatgacaaaataa

DBGET integrated database retrieval system