KEGG   Bacillus subtilis subsp. subtilis 168: BSU35980Help
Entry
BSU35980          CDS       T00010                                 

Gene name
ywsA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3892
Motif
Other DBs
NCBI-GeneID: 936847
NCBI-ProteinID: NP_391479
Pasteur: BG12529
BSORF: BG12529
UniProt: P96728
Position
3707836..3708132
Genome map
AA seq 98 aa AA seqDB search
MDQFEAAYESYKARQTTADQENVPSGKEEIIAVRRNEEDNIIAVKTNTGRELDYPTALSE
AKSGKLAHVDVFHKYGRDILRSEPDGIKENNLSELPDF
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatttgaagcagcatatgaatcgtataaagcccggcaaacaactgccgatcaa
gaaaatgttccatctggaaaagaagaaattattgcggttagaagaaatgaggaagacaat
attatcgcagtgaaaaccaatacaggaagagagctcgactaccctactgcgctgtcagaa
gcaaaatcaggaaaactcgctcatgttgatgtcttccataaatacgggcgtgacattttg
cgaagtgaaccggacggcatcaaggaaaataacctgtctgagctgccggatttttaa

DBGET integrated database retrieval system