KEGG   Bacillus subtilis subsp. subtilis 168: BSU35990Help
Entry
BSU35990          CDS       T00010                                 

Gene name
ywrO
Definition
(RefSeq) general stress protein 14
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_2 FMN_red
Motif
Other DBs
NCBI-GeneID: 936853
NCBI-ProteinID: NP_391480
Pasteur: BG12528
BSORF: BG12528
UniProt: P80871
Position
complement(3708172..3708699)
Genome map
AA seq 175 aa AA seqDB search
MKILVLAVHPHMETSVVNKAWAEELSKHDNITVRDLYKEYPDEAIDVAKEQQLCEEYDRI
VFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSEGNALHGKELMLAVSTGSEAEKYQAGGAN
HYSISELLKPFQATSNLIGMKYLPPYVFYGVNYAAAEDISHSAKRLAEYIQQPFV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattggttttggcagtgcatcctcatatggagacctcagttgttaataaggcg
tgggctgaggaattgagtaaacatgacaatatcacagtacgggatctttataaggaatac
ccggatgaagcgatagatgttgcgaaggaacagcagctgtgcgaggaatacgatcggatt
gtctttcaattcccgctatattggtacagctctccgccgctcttgaaaaaatggcaggat
cttgtgctgacttatggctgggcttttggttcagaaggaaatgccttgcatggcaaggag
ctgatgctggctgtatcaacagggagcgaagcggaaaaatatcaagcgggcggagcaaat
cattactcgatcagtgagctattgaaaccatttcaggccacgagtaatctgatcggcatg
aagtatctgcctccatatgtgttctatggcgtgaattatgcagctgcagaggatatttct
cacagtgcaaaacggttagccgaatacatccagcagccttttgtttaa

DBGET integrated database retrieval system