KEGG   Bacillus subtilis subsp. subtilis 168: BSU36000Help
Entry
BSU36000          CDS       T00010                                 

Gene name
alsD
Definition
(RefSeq) alpha-acetolactate decarboxylase
  KO
K01575  acetolactate decarboxylase [EC:4.1.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00650  Butanoate metabolism
bsu00660  C5-Branched dibasic acid metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU36000 (alsD)
   00660 C5-Branched dibasic acid metabolism
    BSU36000 (alsD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.5  acetolactate decarboxylase
     BSU36000 (alsD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAL_decarboxy
Motif
Other DBs
NCBI-GeneID: 936857
NCBI-ProteinID: NP_391481
Pasteur: BG10472
BSORF: BG10472
UniProt: Q04777
Structure
PDB: 

Position
complement(3708799..3709566)
Genome map
AA seq 255 aa AA seqDB search
MKRESNIQVLSRGQKDQPVSQIYQVSTMTSLLDGVYDGDFELSEIPKYGDFGIGTFNKLD
GELIGFDGEFYRLRSDGTATPVQNGDRSPFCSFTFFTPDMTHKIDAKMTREDFEKEINSM
LPSRNLFYAIRIDGLFKKVQTRTVELQEKPYVPMVEAVKTQPIFNFDNVRGTIVGFLTPA
YANGIAVSGYHLHFIDEGRNSGGHVFDYVLEDCTVTISQKMNMNLRLPNTADFFNANLDN
PDFAKDIETTEGSPE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagaaagcaacattcaagtgctcagccgtggtcaaaaagatcagcctgtgagc
cagatttatcaagtatcaacaatgacttctctattagacggagtatatgacggagatttt
gaactgtcagagattccgaaatatggagacttcggtatcggaacctttaacaagcttgac
ggagagctgattgggtttgacggcgaattttaccgtcttcgctcagacggaaccgcgaca
ccggtccaaaatggagaccgttcaccgttctgttcatttacgttctttacaccggacatg
acgcacaaaattgatgcgaaaatgacacgcgaagactttgaaaaagagatcaacagcatg
ctgccaagcagaaacttattttatgcaattcgcattgacggattgtttaaaaaggtgcag
acaagaacagtagaacttcaagaaaaaccttacgtgccaatggttgaagcggtcaaaaca
cagccgattttcaacttcgacaacgtgagaggaacgattgtaggtttcttgacaccagct
tatgcaaacggaatcgccgtttctggctatcacctgcacttcattgacgaaggacgcaat
tcaggcggacacgtttttgactatgtgcttgaggattgcacggttacgatttctcaaaaa
atgaacatgaatctcagacttccgaacacagcggatttctttaatgcgaatctggataac
cctgattttgcgaaagatatcgaaacaactgaaggaagccctgaataa

DBGET integrated database retrieval system