KEGG   Bacillus subtilis subsp. subtilis 168: BSU36020Help
Entry
BSU36020          CDS       T00010                                 

Gene name
alsR
Definition
(RefSeq) HTH-type transcriptional regulator AlsR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_20 HTH_24
Motif
Other DBs
NCBI-GeneID: 936860
NCBI-ProteinID: NP_391483
Pasteur: BG10470
BSORF: BG10470
UniProt: Q04778
Position
3711498..3712406
Genome map
AA seq 302 aa AA seqDB search
MELRHLQYFIAVAEELHFGKAARRLNMTQPPLSQQIKQLEEEVGVTLLKRTKRFVELTAA
GEIFLNHCRMALMQIGQGIELAQRTARGEQGLLVIGFVGSATYEFLPPIVREYRKKFPSV
KIELREISSSRQQEELLKGNIDIGILHPPLQHTALHIETAQSSPCVLALPKQHPLTSKES
ITIEDLRDEPIITVAKEAWPTLYMDFIQFCEQAGFRPNIVQEATEYQMVIGLVSAGIGMT
FVPSSAKKLFNLDVTYRKMDQIQLNAEWVIAYRKDNHNPLIKHFIHISNCQQTRTKESDA
GT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggagcttcgccatcttcaatactttatcgcagtagccgaagagcttcatttcggaaag
gctgcccggcggctgaacatgacgcagcctcctctcagccagcagatcaaacagctggag
gaagaagtcggagttacgcttctgaaaaggacaaaacgatttgtcgagcttaccgcagca
ggagaaatctttttaaatcattgccgcatggcattgatgcaaatcggacaaggaattgaa
ctggcacagcggacggcccgcggcgagcaaggccttctcgtaatcggttttgtcggatca
gctacatatgaatttctgccgccgattgtccgggaatatcgtaaaaaattcccatctgtg
aaaatagaactgcgtgaaatatcctcgtctaggcagcaggaggagctactaaagggcaac
attgatattggtatacttcatcctcccttacagcatacagctttacatatcgaaaccgcc
caaagcagcccttgtgttttagctttgcctaagcaacacccattgacttctaaggaatca
attacgattgaggatttaagagatgaaccaattattactgttgctaaagaagcatggcct
actctatacatggattttattcagttctgtgaacaagcgggcttcagacccaacattgtc
caggaagccacagaatatcaaatggtgattggtttagtcagtgccggaattggtatgaca
tttgttccttcctcggccaaaaaattatttaatttggatgttacttatcgaaaaatggac
caaatacagcttaatgcagaatgggttatcgcttaccgcaaagacaatcataatccgctt
ataaagcattttattcatatttcaaattgtcagcagacaagaactaaagagagtgatgca
ggtacatga

DBGET integrated database retrieval system